SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007946 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007946
Domain Number 1 Region: 1029-1077
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 1.96e-17
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 2 Region: 249-354
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.93e-16
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00099
Further Details:      
 
Domain Number 3 Region: 105-170
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000131
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 4 Region: 36-91
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000746
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007946   Gene: ENSSSCG00000007458   Transcript: ENSSSCT00000008162
Sequence length 1390
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:55850658:55874662:-1 gene:ENSSSCG00000007458 transcript:ENSSSCT00000008162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGQGVIDKDSLGPLLLQALDGFLFVVNREGNIVF
VSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKSTVNGVTWTNETQRQKSHTFN
CRMLMKIPHDILEDMNTSPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTG
ERAFPSNPESFITRHDLSGKVVSIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQK
RHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHSFVSTHFLQREQNGY
RPNPNPVGQGVRPPAAGCNSSVGSMNMSPNQGLQMLSSRTYGLADPSTTGQMTGARYGAA
GSIASMNPGPGMQSPSSYQNSNYGLNMSSPPHGSPGLGSNQQNIMISPRNRGSPKMASHQ
FSPVAGVHSPMGSSGSTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNI
TQPSKVSSQDSKSPLGLYCDQNPVESSMCQSNSRDHLNDKESKESSVEGSENQRGPLESK
GHKKVLQLLTCSSDDRGHSSLTNSPLDSGCKDSAISVTSPSGVSSSTSGGVSSTSNMHGS
LLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCVEGNVKQEQLSPKKKENNAL
LRYLLDRDDPSDTLSKELQPKVEGVDGKMSQCSSSALPSSSQEKDSKIKTETNEEGSGDL
DNLDAILGDLTSSDFYNNSISTNGSNLGTKQQMFQGTNSLGLRSPQSVQSVRPPYNRAVS
LDSPVSVGSNPSVKNISAFPMLTKQPLMGGNPRMMDGQENYGSAMGGPNRNVAVNQTPSS
GDWGLPNSKASRMEPMNPNSMGRPGTDFNASLPRPAVGGSMPTMPLRSNSIPGARPVLQQ
QQQQQQQMLQMRPGEIPVGMGVGPYGQGAPSNQPGSWPDGMLSMEQGPHGTQNRPLLRNS
LDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQD
AFQGQEAAVMMEQKAALYGQTYPAQGPPMQGGFNLQGQSPSFNSMMNQMNQQGNFPLQGM
HPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQNRQALEMKMESPSAGGAAVMRPMMQPQ
VSSQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQTQAFSPPPNVTASPSMDG
VLAGPSMPQAPPQQFPYPPNYGMGQQPDPAFGRVSSPSNAMMSSRMGPSQNPMMQHPQTA
PMYQSSDMKGWPSGTLARNSSFPQQQFAPQGNPAAYSMVHMNGSSGPMGQMNMNSVPMTG
MPMGPDQKYC
Download sequence
Identical sequences ENSSSCP00000007946 ENSSSCP00000007946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]