SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008030 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008030
Domain Number 1 Region: 41-296
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.81e-73
Family Papain-like 0.000000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008030   Gene: ENSSSCG00000007522   Transcript: ENSSSCT00000008249
Sequence length 304
Comment pep:known chromosome:Sscrofa10.2:17:66511905:66519788:-1 gene:ENSSSCG00000007522 transcript:ENSSSCT00000008249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGPPPPLLLLLLVLLAGAARAGLHFRPGCSCYRPLRGDQRTQLGHRTYPRPHEYLSP
SDLPRSWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGAWPSTLLS
VQHVIDCGNAGSCEGGDDLPVWAYAHRHGIPDETCNNYQAKDQVCDKFNQCGTCTEFKEC
HVIQNYTLWKVGDYGSVSGREKMMAEIYANGPISCGIMATEKMSNYTGGIYAEYKDQAYI
NHIVSVAGWGVSGGTEYWIVRNSWGEPWGERGWMRIVTSTYKDGRGAHYNLAIEENCTFG
DPIV
Download sequence
Identical sequences A5GFX7
ENSSSCP00000008030 9823.ENSSSCP00000008030 ENSSSCP00000008030 NP_001116576.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]