SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008115 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008115
Domain Number 1 Region: 109-185
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.14e-17
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008115   Gene: ENSSSCG00000007594   Transcript: ENSSSCT00000008334
Sequence length 189
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:5091945:5106415:-1 gene:ENSSSCG00000007594 transcript:ENSSSCT00000008334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIVDKASESSDPSTYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGA
VVYSSSTVPEKSKPSPQKDQALGDGIAPPQKVLFPSEKICLKWQQTHRVGAGLQNLGNTC
FANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVI
NEMRRKYLL
Download sequence
Identical sequences ENSSSCP00000008115 ENSSSCP00000008115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]