SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008195 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008195
Domain Number 1 Region: 148-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.07e-31
Family MAM domain 0.012
Further Details:      
 
Domain Number 2 Region: 28-142
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000301
Family MAM domain 0.011
Further Details:      
 
Domain Number 3 Region: 1064-1124
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000392
Family BSTI 0.033
Further Details:      
 
Domain Number 4 Region: 1451-1511
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000018
Family BSTI 0.047
Further Details:      
 
Domain Number 5 Region: 1845-1908
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000621
Family ATI-like 0.02
Further Details:      
 
Domain Number 6 Region: 2252-2311
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000343
Family BSTI 0.034
Further Details:      
 
Domain Number 7 Region: 2368-2401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000599
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 688-741
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000103
Family ATI-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008195   Gene: ENSSSCG00000007674   Transcript: ENSSSCT00000008414
Sequence length 2475
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:8032726:8095772:1 gene:ENSSSCG00000007674 transcript:ENSSSCT00000008414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLPALAGPMAMPHPPLIPSTPTLLAFSFPGGFYMLLDPKNAKPRQRSALLSPLIQSSG
CLSLSFQYTQRGQASGATLMVYASVLGSIRKHTLFSGQPGPSWQPVSVNYTSQGQIQFTL
VGVFGKIPEPAVAVDAISIAPCEESFPQCDFEDNAHPFCDWVQASQDGGYWRQGNKNTFI
QPAGPFGISLNGEGHYIFLETDKFSQAGQSFRLVSRPFCAPAVICVTFTYHMYGLGQGTK
LRLLLGSPAGSPPSSLWERVGPQSPEWLNTSVTIPSGHQQPMQLIFEAVRGTNTAFVVAL
GFVLINHGTCRGPSETSVSTEKPVAPTEKPTVPSEIYTIPTEKPMVHMEKPIVHTEKPTV
PTEKPTIPTEKSTVPTKKPTVFKEPTLPPEGPTVPAEQPTTPPEGPAVPPKGPTVLTEWP
TSHTEKSTVHTEKPILPTGKSTIPTEKPMVPTKRTTTPTERTTIPAEKPTVPIEKPMVPT
ERTTIPTERTTIPTEKPTVPTEKLTVPTEKPIVPTEKPIVPTEKHTIPTEKLTVLTERTT
TPTERTTIPTEKPTVPTEKPSVPTEKPTVPTEEPTIPTEKLTVPTERTTTPTKRTTTPTI
RTTTPTIRTTTPTERTTTPTIRTTTPTERTTIPTKKTTVPTEKTIIPTERTIAPTTPQPS
PTLVPTQPAAVVMPSTSATTVTPRTTIASCPPNAHFERCACPVSCQSPTPNCELFCKPGC
VCDPGFLFSGSHCVNASSCDCFYNDNYYKLGTDWFSPNCTEHCHCRPSSRMECQTFKCGT
HTVCQLKNGQYGCHPYGSATCSVYGDPHYLTFDGRRFNFMGKCTYILAQPCGNLTEHFFR
VLVKKEERGQEGVSCLSKVYVTLPESTVTLLKGRHTLVGGQRVTLPAIPSRGVFLAPSGR
FVELQTAFGLRVRWDGDQQLFVSVPSTFSGNSGLCGDYDGDSSNDNQKPDGSPAKDEKEL
GSSWQTSEDADQQCEENQVSPPSCNTALQNTMSGPEFCGQLVAPHGVFEACLPHLRASSF
FKSCTFDMCNFQGLQHMLCAHMSALTENCQDAGYTVKPWRGPQFCPLACPRNSRYTLCAR
LCPDTCHSEFSGRACKDRCVEGCECDPGFVLSGLQCVSRSECGCLDSTAGYVKVGERWFK
PGCRQLCICEGNNRTRCVLWRCQAQEFCGQQDGIYGCHAQGSATCTVSGDPHYLTFDGAL
HHFTGTCTYTLTKPCWLRSLENSFLVSATNEFRGGNLEASYVRAVQVQVFNLRISLIKGR
KVTLDGRRVALPLWPAQGRVSIMSSGSFILLYTDFGLQVRYDGDHLVEVTVPSSYAGRLC
GLCGNYNNNSLDDILQPDKRPASSSVRLGASWKINELSEPGCFAEGGKPPRCLGKEVADA
WRKNCDVLMNPQGPFSQCHRVVAPQSSFSSCLYGQCATKGDTLTLCRSLQAYASLCARAG
QALTWRNGTFCPLKCPSGSSYSTCANPCPATCLSLNNPSYCPSTLPCAEGCECQKGHILS
GTSCVPLSQCGCTTQRGSYHPVGESWYTDNSCSRLCTCSAHNNISCRQASCKPSQMCWPQ
DGLIRCRVAGMGVCRIPDTSHYVSFDGSYHAVRGNCTYVLVKICHSTMDLPFFKISGENG
KREGQPPAFYLRQVYVDIFNTLVTLKQDQVLINGTRVSLPATTQIRGVRVISRDGYTVLT
INIGVQVKFDGRGFLEVEIPKAYYGRTCGVCGNFNDEEEDELMMPSDALALDDVMYVDSW
RDKEIDPNCQEDDRKTEAESQEQPSANCRPADLERAQEQCQAAFQAPAWANCATRVVLSP
YVRSCTHKLCEFGGLNRAFCESLQAFGAACQAQGIKPPVWRNSSFCPLDCSAHSVYTSCV
PSCLPSCQDPEGQCTGAGAPSTCEEGCICEPGYVLSEQQCVARSQCGCRDARGTFLPVGR
FRLSSGCSQMCVCTAGAIECRPFTCPSGSQCEPNEDGKDFCQPNSSNLCSVFGDPHYRTF
DGLSYRFQGRMTYTLVKTLDVLPDGVEPLVVEGRNKVYPSLTPVFLQEIIVMVYGYTVQL
QAELELVVNGQKVSIPYKPNEYLQVTLRGRRLYLVTDFELVVSFNGRNNAVIAMPSTYLG
LVRGLCGNYDKNKRNDFMLPNGSFTQNLLVFGNSWEVKAKEGHPRFSRAIREEEEKNEES
GFQNVSECSPEQLELVNHTQACGVLVDPQGPFAACHQIVAPGPFQEHCVFDLCAAPGPKE
QEELRCQVLSGYAIICQESGATLAGWRDHTHCALPCPANTVYQSCMTPCPASCATLAVPR
ACDGPCVEGCASLPGYIYSGAQSLPMAHCGCTNNGVYYQQGDSFVTENCSQRCTCASSGV
LLCEPLSCRPGEICTLGNLTRGCFRDSPCLQNPCQNDGRCREQGTHFTCECELGYGGDLC
TEPRGVPSPKKPEASNRVAILLGMLMPTVLLVPAVTRVSRKRRRRRRPSRERTQSQNRGK
RAGTDCAPEQAYKVA
Download sequence
Identical sequences ENSSSCP00000008195 ENSSSCP00000008195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]