SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008197 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008197
Domain Number 1 Region: 609-886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.47e-79
Family Protein kinases, catalytic subunit 0.00000000064
Further Details:      
 
Domain Number 2 Region: 17-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-63
Family Ephrin receptor ligand binding domain 0.00000000961
Further Details:      
 
Domain Number 3 Region: 322-527
Classification Level Classification E-value
Superfamily Fibronectin type III 5.56e-33
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 4 Region: 905-974
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.53e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 5 Region: 250-320,361-374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000224
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008197   Gene: ENSSSCG00000007675   Transcript: ENSSSCT00000008416
Sequence length 987
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:8095621:8116670:-1 gene:ENSSSCG00000007675 transcript:ENSSSCT00000008416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRALLCWASLAAALEETLLNTKLETADLKWVTFPQVEGQWEELSGLDEEQHSVRTYEV
CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYFESDA
DTATAHTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLTKAGFYLAFQD
QGACMALLSLHLFYKKCAQLTVNLTHFPETVPRELVVPVAGSCVADAMPGSGPSPSLYCR
EDGQWAEQPVTGCSCAPGFEAAEGNTRCRACGQGTFKSQSGEGSCQTCPANSQSNTIGSS
VCQCRIGYFRARTDSRGAPCTTPPSAPRSVVSRLNGSSLRLEWSAPLESGGREDLTYALR
CRECRPGGSCMPCGGDLTFDPGPRDLVEPWVAIRGLRPDFTYTFEVTALNGVSSLASGPV
PFEAVNVTTDREVPPPVSDIRVTRSSPSSLSLAWTVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDEHESWREQLAL
IAGTAVVGVVLVLVVIVIAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSVPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISTEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGAPGGSGAPAPQY
Download sequence
Identical sequences F1RMX5
ENSSSCP00000008197 9823.ENSSSCP00000008197 ENSSSCP00000008197 XP_003124419.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]