SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008227 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008227
Domain Number 1 Region: 286-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-52
Family SPRY domain 0.0000867
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-19
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 82-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.41e-16
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008227   Gene: ENSSSCG00000007703   Transcript: ENSSSCT00000008446
Sequence length 486
Comment pep:known chromosome:Sscrofa10.2:3:10351991:10359671:-1 gene:ENSSSCG00000007703 transcript:ENSSSCT00000008446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQVSVPELEDRLQCPVCLEVFKEPLMLQCGHSYCKGCLLSLSRHLDSELRCPVCRQEV
DSSSSPPNVSLARVIEALQLPGDPEPQVCTHHRNPLSLFCEKDQELICGLCGLLGSHQHH
RVTPVSTVYSRMKEELAALISDLKQEQKKVEEQVAKLVNNRTRIVNESDVFSWVIRREFQ
ELHHLVDEEKARCLEGVEGHTRGLVASLDMQLEQARGAQERLAQATCMLEQFGNESHYEF
IRYHSTASSAELQQARLLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPESLKLDPT
TAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASRGFSCGRHYWEVVVGSKSDW
RLGVIKGTASRKGKLNKSPEHGVWLIGLKEGRVYEAFSCPRVPLPVAGHPHRIGVYLHYE
QGELTFFDADRPDDLRLLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPLPSGPGHLTP
SQPTKL
Download sequence
Identical sequences Q865W2
ENSSSCP00000008227 ENSSSCP00000008227 NP_999351.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]