SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008285 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008285
Domain Number 1 Region: 281-470
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-40
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily RING/U-box 1.27e-18
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 75-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000778
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008285   Gene: ENSSSCG00000007757   Transcript: ENSSSCT00000008504
Sequence length 478
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:17575285:17583480:1 gene:ENSSSCG00000007757 transcript:ENSSSCT00000008504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPSCQAPT
RPQALSTNQQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRVLVCGVCASLGSHRGHRLL
PAAEAHARLKTQLPQQKLQLQEACMRKEKSVGVLEQQLVEVEETVRQFRGAVGEQLGKMR
LFLAALEGSLDREAERVRGEAGVALRRELGSLKSYLEQLRQMEKVLEEVADKPQTEFLMK
YCLVTSRLQKILAESPPPARLDIQLPVISDDFKFQVWRKMFRALMPAMQELTFDPSTAHP
SLVLSASGRRVECSEQKAPPAGEDPRQFDKAVAVVTHQLLSEGEHYWEVEVGDKPRWALG
VIGAQAGRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRTPERRPSRIGIYLSFA
DGVLSFYDASDADALELLFAFHERLPGPVYPFFDVCWHDKGKNAQPLLLVGPDSGGEA
Download sequence
Identical sequences A0A1W6R2B4
ENSSSCP00000008285 ENSSSCP00000008285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]