SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008288 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008288
Domain Number 1 Region: 603-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.7e-89
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 1-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.2e-80
Family Eukaryotic proteases 0.0000552
Further Details:      
 
Domain Number 3 Region: 298-519
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.97e-37
Family Eukaryotic proteases 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008288   Gene: ENSSSCG00000007760   Transcript: ENSSSCT00000008507
Sequence length 855
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:17507953:17525512:-1 gene:ENSSSCG00000007760 transcript:ENSSSCT00000008507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIMGGSDARPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFMNNGTLEPAAEWSVVL
GVHSQDGPLDGAHIRAVAAILVPDNYSSVEQGADVALLRLASPARLGPAVRPVCLPRASH
RFARGTACWATGWGDVQEADPLPLPWALQEVELRLLGEAACQCLYSRPGPFNLTFQLLPG
MLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVAPYEAW
IREKVMGSEPGPAFPTQSPEPQSGLPEPMDENCTIALPETALGSGGPLTQASHPSECGKA
LRPGAWPWEAQVMVPGSRPCYGALVSESWLLAPASCFSGRVSSDQPPGDLENWHVLLPSR
PRAEQVARLVLHENASWDDASDLALLQLRVPVNLSAAPRPVCLPHPEHYFLPGSRCRLAR
WGRGVRVRRVRSPVPVAAAVSILTARLCHCLYQGILPPGTLCVLYAEGQEDSCEVTSAPP
LLCQTEGGSWVLVGMALRGSRELFAAVGPEETWISQTVALAPPAAPPRPAPSQARVTISV
LRRQSGGGERSPPGKLEVLGRWRRWTEVPNRPSSTTRRAQHTSPHTDEAASSTEGTGAKG
DAVSCGIVPQAQGRITGGSNSDPGQWPWQVSINYNGEHVCGGSLVSDQWVLSAAHCFPRD
HSTSAYEVKLGAHQLDSFSSSMTVRTVAQVISHPSYLQEGSEGDIALLQLSSPVTFSRYI
WPICLPAANASFPNGLQCTVTGWGHVAPSGERPRTLQQLEVPLISRETCNCLYNIDANPD
EPHFIQQDMLCAGYVKGGKDACQGDSGGPLSCPAGGHWYLAGIVSWGDACGAPNRPGVYT
LTSTYASWIQHNVAE
Download sequence
Identical sequences ENSSSCP00000008288 ENSSSCP00000008288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]