SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008293 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008293
Domain Number 1 Region: 9-270
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-61
Family Eukaryotic proteases 0.0005
Further Details:      
 
Domain Number 2 Region: 306-524
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-48
Family Eukaryotic proteases 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008293   Gene: ENSSSCG00000007765   Transcript: ENSSSCT00000008512
Sequence length 554
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:17721755:17727016:1 gene:ENSSSCG00000007765 transcript:ENSSSCT00000008512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSWGPGLLILGAVVLIEGLQAAQRVCGQRGPGPPEPQEGNTVPGEWPWQASVRRQGLH
LCSGSLVADTWVLTAAHCFEREAMTDLNSWSVVLGSLQHEGLSTGAEEVGVTALQLPRAY
NHYSQGADLALLQLAHPVAHTPLCLPQPGHRFPFGTSCWATGWDQDPKDAPRTLRNLRLR
LISRPTCNCLYDRLHQRLLASPARPGMLCGGPQPGVQGPCQGDSGGPVLCREADGHWVQA
GIISFASSCAQEDTPVLLTDMAAHSSWLQARAQGAAFLAQNPEAPEMSDEDSCVACGSLK
RGSPQAGAPSPWPWDARLKHQGKLACGGALVSEEVVLTAAHCFIGRQAPEEWTVGLGARS
EERGLRQVILHGAYTHPEGGYDVALLLLAQPVTLGPSLRPLCLPYADHRLPDGEHGWVLG
LARKGADTGSPQTVPVTLLGPRACSRLHATFGGDSVPILPGMVCTSVVGKPPGCEGLSGA
PLVHEVRDRWFLAGLHSFGDACQGPTSPAAVFAALPTYENWVSSLDWQVYFAEEPEPEAE
PGSCPANMSQPAGC
Download sequence
Identical sequences F1RIR5
ENSSSCP00000008293 9823.ENSSSCP00000008293 ENSSSCP00000008293 XP_003124544.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]