SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008441 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008441
Domain Number 1 Region: 210-551
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.3e-100
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000255
Further Details:      
 
Domain Number 2 Region: 69-198
Classification Level Classification E-value
Superfamily TRAF domain-like 1.05e-28
Family MATH domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008441   Gene: ENSSSCG00000007907   Transcript: ENSSSCT00000008664
Sequence length 1103
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:34686456:34742973:-1 gene:ENSSSCG00000007907 transcript:ENSSSCT00000008664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHQQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVAMSDGHNNTEEDM
EDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFL
QCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDP
EKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLR
KAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQEL
CRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKN
IFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNI
KINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCK
FDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESRLSEVLQAVTDHDIPQQ
LVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKN
SSLAEFVQNLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWT
IFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPV
MCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSE
LPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQF
FKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWL
NSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELL
ECLSPATSRTFRIEEVPLDQVAIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFRE
VMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGL
DHFNKAPKRSRYTYLEKAIKIHN
Download sequence
Identical sequences F1RKZ6
ENSSSCP00000008441 ENSSSCP00000008441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]