SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008480 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008480
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily Heme oxygenase-like 5.19e-74
Family Eukaryotic type heme oxygenase 0.000000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008480   Gene: ENSSSCG00000007942   Transcript: ENSSSCT00000008704
Sequence length 316
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:38895256:38922993:-1 gene:ENSSSCG00000007942 transcript:ENSSSCT00000008704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVELETSEGVDEPEEKSSGAPEKENHTRMADLSELLKEGTKEAHDRAESTQFVKDFLKG
NIRKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKEALVKDMEYFYGGD
WEEQAQCSEATRKYVERIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQFYRARMNALDLNLETKEKIVEEANKAFEYNMQVFNELDQA
GSLLAKETLADGLPVHDGKGDVRKCPYYSGEQDKGALEGSSCPFQTALAVLSKPSLQFLL
AASVALAASLLAWYYM
Download sequence
Identical sequences A0A287B1I6
ENSSSCP00000008480 NP_001231341.1.46622 XP_013851126.1.46622 XP_020941479.1.46622 9823.ENSSSCP00000008480 ENSSSCP00000008480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]