SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008483 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008483
Domain Number 1 Region: 70-250,538-697
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.14e-45
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008483   Gene: ENSSSCG00000007944   Transcript: ENSSSCT00000008707
Sequence length 923
Comment pep:known chromosome:Sscrofa10.2:3:38983198:39040299:1 gene:ENSSSCG00000007944 transcript:ENSSSCT00000008707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRFKVSKFRHTEARPPRREAWISDIRAGTAPSCGNHIKSSCSLIAFISDRPGVLGIVPL
EGQGEDKRHVTHLGCHSDLVTDLDFSPFDDFLLATASADRTVKLWRLPAPGQALPSGPGL
VLGPEDVPVEVLQFHPSADGVLLSAAGKALKVWDAARQQPLTELAAHGDLVQSAIWSQDG
ALVGTTCKDKQLRIFDPRAKPEASQSTQAHENSRDGRLVWTGTREHLVSTGFNQMREREV
KLWDIRLFSGALASLTLDASPRSLMPLLDPDSGLLVLAGKGESQLSCYEVAPQQPVLSPV
TQCLLESALRGAALVPRRALAVLGCEVLRVLQLSDSAIVPISYHVPRKAAEFHEDLFPDA
AGSTPASDAQAWWAGSNQQVQRVSLHPARRPLPSFTSRLVSPAQPSPDAAQPAKTPAGDA
DPSDGFSSPPSSLTSPSTPSSLGPSLSSTSGIGTSPSQRSLQSLLGPSSKFRHTQGTVLH
RDSHITNLKGLNLTTPGESDGFCANRLRVAVPLLSSGGQVAVLELRKPGRLPDTALPTLQ
NGAAVTDLAWDPFDLHRLAVAGEDARIRLWRVPPEGLEEVLTTPEAVLTGHTEKIYSLRF
HPLAADVLASSSYDLTIRIWDLQAGVERLRLQGHRDQIFGLAWSPNGQQLATVCKDGRLR
VYEPRSSPEPLQEGPGPEGARGARVVWVCDGHCLLVSGFDSRSERQLLLFSAEALASGPL
AVLGLDVAPSTLLPSYDPDTSLVLLTGKGDTRVFLYELLPEAPFFLECNSFTSPDPHKGF
VLLPKTECEVREVEFARCLRLRQTSLEPVAFRLPRVRKEFFQDDVFPDTAVSWEPVLSAE
AWLGGANGQPRLLSLQPLGMTPVSQAPREAPARRAPPSALYLEEKSDQQKKEELLSAMVA
KLGNREDPLPQDSFEGVDEDEWD
Download sequence
Identical sequences F1RK53
XP_005662233.1.46622 ENSSSCP00000008483 ENSSSCP00000008483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]