SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008532 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008532
Domain Number 1 Region: 1314-1576,1686-1731
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.42e-41
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 2 Region: 851-1011,1117-1258,1309-1370
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.51e-40
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 3 Region: 402-464,631-817
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.94e-37
Family WD40-repeat 0.0054
Further Details:      
 
Domain Number 4 Region: 361-651
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.15e-18
Family WD40-repeat 0.0079
Further Details:      
 
Domain Number 5 Region: 1594-1743
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000022
Family WD40-repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008532   Gene: ENSSSCG00000007991   Transcript: ENSSSCT00000008756
Sequence length 1752
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:41354410:41369701:1 gene:ENSSSCG00000007991 transcript:ENSSSCT00000008756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPVWQHPFLNVFRHFKVDEWKRSTKEGDVAAVTDKTLKCSVYRVRGSISAANYIQLPKT
STQSLGLTGRYLYVLFRPLPTKHFVIHLDVATEDSQVIRLSFSSLYKEVKSTATWLQFPF
VCEPGAPRKELAGVAPPGTRWTCLQLDLPDLLLVYLNRRHSHLKSVRLCASLLVRSLYTS
DLCFDPAVTVAEARRAKLSVTPIPREMAFPVPKGESWHDHYVHIRFPNDRWKRPSETVQG
GCPPPEAGRQGQGPLLPQPATLSKPLQDSASPVARKRGPTASHRASLAPSPLLDVSLSCR
RSESSSAGGPSGRSHKPGAQVEATDEHAAGDALHVSACQPAVAPTAPEATAPRGSFLPDP
ILRLKGAIGFGGHSTTWALWTRDGAAVVYPCHAVIVVLSIDTQEQRFFLGHTDKVSALAL
DGRGALLPSAQAQPPSMLRLWDFRTGRCLHLFRSPGHAVCSLSFSDSRELLCGVGKDCRG
RTVAVVWGTEQVGRGGEAAVLAKARTDVHVQACEFAFSEETRMASCGRGSVRLWRLRGGG
LRSCPVNLGEHQALEFTDLAFRQDQDGQTPLLVTSPHSYVCSRSGHILEVDCQRMAVRRA
RRLLPAQSPGDSLPQKQNFPSGPGIAISSLSVSQTTCAVGSEDGFLRLWPLDFSAMLLET
ELEGPVSSVRLSPDGLRVLSTTSSGLLGFLDVASREYRVLARSHTAPVLALAAECSRGQL
ATVSQDCTVRIWDQATLQQLYEFTSREEAPCAVAFHPVQPTFFCGFSSGAVRSFNLEAPE
VLVEHRCHQGAITGLVASPDGSLLFSSCSRGALAQYHSGAPHCRVLRVAANVVCQACLGP
GALAVSGDSRLLAVVGPSKNTVTVMDTASLDELLRVDVSTLDPAGGRLDSAMAVCFGPCT
AHLLVSTFSNTVAVLDATSGRVVRELSCVPPAVCSCLAVSEDGRFLLTAGHRAIRLWDYL
AEAGPTCQVFIGHSEPVRAVAFIPGQRQLLSVGDAVFLWDILAPPEQCPPERTARLLPSS
GLRARQPEDTVSEASELPQQPAPAPSQASPPQPSICTRPPEGYDGHRSTLSPPSPRLPPP
VLALSSSLLLCMPSPARGLSFPGAGDERLRLKAVLGYNGNGRANLVWRPDTGFFAYTCGR
LVVVEDLHSGAQQHWLGHPREISTLALSTTPSQVLASASSRISADSCQIRLWDVPGGSCR
QLLFHHDTAVQALAFSPDDRLLVTLGDCRDHTLALWSLATHELLSSVPLPEPVHGVAFNP
WDASKLTCVGRGAVTSWLLQQRGGSVSLQVHREPTPEEVGACELTSLCFGAAPLLYCGSH
TGRLCVWDMRADRCFLAWEADDGQIGVLLSGGERLVSGSNTRRLRLWAVGAVPELRRKGS
SARSGGSVFLEGELTLDGAVVSAVFHDSMDMGVVGTAAGTLWYVSWAEGASTRLVSGHRS
QVNEVVFSPGGSRCATCSNDGSLRVWSLASMELLIQFQVLSQSCLCLAWSPPSCGRPEQQ
QVAAGYGDGTLRVFSVSRMAMELKMHPHPAAVTAVVFSADGQTLLSGDKEGLVAVSRPRT
GVTLRVLRDHRGAPICTIQSTRKEYGDFGAEGADLWLAASGDQRVSVWASDWPQNHCELV
DWLSFPAPALTEVPGCLPPSLAAFCPWDGALLACVGLGLHHEVLFYSLRQKQVVERIPLP
FLAVSMSLSPRACLVAVGFAEQMLRLVDCASGAVQDFAGHADSVQLCRFSPSARLLFTAA
HTQILMWEVVGP
Download sequence
Identical sequences ENSSSCP00000008532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]