SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008534 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008534
Domain Number 1 Region: 431-781
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.18e-103
Family Calpain large subunit, catalytic domain (domain II) 0.0000129
Further Details:      
 
Domain Number 2 Region: 6-30
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000121
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 
Domain Number 3 Region: 393-420
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000133
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Domain Number 4 Region: 123-150
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000204
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 
Domain Number 5 Region: 44-69
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000432
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008534
Domain Number - Region: 326-351
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00738
Family Ran binding protein zinc finger-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008534   Gene: ENSSSCG00000007993   Transcript: ENSSSCT00000008758
Sequence length 1064
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:41290181:41296917:1 gene:ENSSSCG00000007993 transcript:ENSSSCT00000008758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGEWSCARCTFLNPAGQRQCSICEAPRHKPDLDQILRLSVEEQKWPCARCTFRNLLG
RAACEVCGFAPEPVPGTSLLPVINGVLPKPPTILLEPQGGCKEEAGPARTAGPPVAAAEG
AGEGGGWACQRCTLHNTPVASSCSACGGPRKLSLPRIPPEALVVPEVVAPAGFPVAPAPP
QPGEGAEADPPSAAVDQEPPGGPPFPFSPALQNNPMPRSRREVPPQLQPPVPWLQGPPPP
TAGYKGPPQGLGRTGGASRLAELLSGKRLSLLEEEAAAEGGPMLRPPGPASPAHCEAGGA
MPGGDIIDLAGDTVRYTPASPSSPDFTTWSCAKCTLRNPTAAPRCTACGCSKLHGFQEHG
EPPARCPDCSGDRAGPCSVHKAGRPLPPAPSERPGQWACPACTLLNPPRAKHCAACHTPQ
LLVAQRRVPLRRRESMHVEKRRQTDEGEAKALWENIVAFCRENSVNFVDDSFPPGPKSVG
FPAGDSVQQRVRQWLRPHEINCSVFRDHSASWSVFHTLRPSDILQGLLGNCWFLSALAVL
AERPDLVERVMVTRSLCAEGAYQVRLCKDGTWTTVLVDDMLPCDEAGCLLFSQAQRKQLW
VALIEKALAKLHGSYFALQAGRAIEGLATLTGAPCESLALQVSSTNPREEPVDTDLIWAK
MLSSKEAGFLMGASCGGGNMKVDDVAYESLGLRPRHAYSVLDVRDVQGSRLLRLRNPWGR
FSWNGSWSDEWPHWPGHLRSELMPHGSSEGVFWMEYSDFVRYFDSVDICKVHSDWQEARV
QGSFPCSASGPVGVTALTVLERASLEFALFQEGSRRADSVDSHLLDLCVLVFRASFGGGG
RLSLGRLLAHSKRAVKKFVNCDVMLEPGEYAVVCCAFNHWGPAPGPPAAQASSPSTGVPR
GAPEPPGHVLAVYSSRLVMVEPVEAQPTTLADAIILLTESRGERHEGREGMTCYYLTHGW
AGLIVVVENRHPRSYLHVQCDCSDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAG
FSITHRLAHRKAAQAFLSDWTTSRGSHSPPLTPEVAGLHGPRPL
Download sequence
Identical sequences ENSSSCP00000008534 9823.ENSSSCP00000008534 ENSSSCP00000008534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]