SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008535 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008535
Domain Number 1 Region: 424-774
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.16e-103
Family Calpain large subunit, catalytic domain (domain II) 0.0000129
Further Details:      
 
Domain Number 2 Region: 6-30
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000119
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 
Domain Number 3 Region: 386-413
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000133
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Domain Number 4 Region: 123-150
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000204
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 
Domain Number 5 Region: 44-69
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000432
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008535
Domain Number - Region: 319-344
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00738
Family Ran binding protein zinc finger-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008535   Gene: ENSSSCG00000007993   Transcript: ENSSSCT00000008759
Sequence length 1057
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:41290181:41296917:1 gene:ENSSSCG00000007993 transcript:ENSSSCT00000008759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGEWSCARCTFLNPAGQRQCSICEAPRHKPDLDQILRLSVEEQKWPCARCTFRNLLG
RAACEVCGFAPEPVPGTSLLPVINGVLPKPPTILLEPQGGCKEEAGPARTAGPPVAAAEG
AGEGGGWACQRCTLHNTPVASSCSACGGPRKLSLPRIPPEALVVPEVVAPAGFPVAPAPP
QPGEGAEADPPSAAVDQEPPGGPPFPFSPALQNNPMPRSRREVPPQLQPPVPPTAGYKGP
PQGLGRTGGASRLAELLSGKRLSLLEEEAAAEGGPMLRPPGPASPAHCEAGGAMPGGDII
DLAGDTVRYTPASPSSPDFTTWSCAKCTLRNPTAAPRCTACGCSKLHGFQEHGEPPARCP
DCSGDRAGPCSVHKAGRPLPPAPSERPGQWACPACTLLNPPRAKHCAACHTPQLLVAQRR
VPLRRRESMHVEKRRQTDEGEAKALWENIVAFCRENSVNFVDDSFPPGPKSVGFPAGDSV
QQRVRQWLRPHEINCSVFRDHSASWSVFHTLRPSDILQGLLGNCWFLSALAVLAERPDLV
ERVMVTRSLCAEGAYQVRLCKDGTWTTVLVDDMLPCDEAGCLLFSQAQRKQLWVALIEKA
LAKLHGSYFALQAGRAIEGLATLTGAPCESLALQVSSTNPREEPVDTDLIWAKMLSSKEA
GFLMGASCGGGNMKVDDVAYESLGLRPRHAYSVLDVRDVQGSRLLRLRNPWGRFSWNGSW
SDEWPHWPGHLRSELMPHGSSEGVFWMEYSDFVRYFDSVDICKVHSDWQEARVQGSFPCS
ASGPVGVTALTVLERASLEFALFQEGSRRADSVDSHLLDLCVLVFRASFGGGGRLSLGRL
LAHSKRAVKKFVNCDVMLEPGEYAVVCCAFNHWGPAPGPPAAQASSPSTGVPRGAPEPPG
HVLAVYSSRLVMVEPVEAQPTTLADAIILLTESRGERHEGREGMTCYYLTHGWAGLIVVV
ENRHPRSYLHVQCDCSDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRL
AHRKAAQAFLSDWTTSRGSHSPPLTPEVAGLHGPRPL
Download sequence
Identical sequences ENSSSCP00000008535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]