SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008562 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008562
Domain Number 1 Region: 970-1174
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000156
Family WD40-repeat 0.021
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008562
Domain Number - Region: 525-578
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00126
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 40-172
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00418
Family BAR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008562   Gene: ENSSSCG00000008018   Transcript: ENSSSCT00000008786
Sequence length 1336
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:41662214:41705674:-1 gene:ENSSSCG00000008018 transcript:ENSSSCT00000008786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKK
ELQVQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNNQTEGSLPGRSRKERPTSLNVFPLADGMVRAQTGGKLVPAGDHWHLSDLG
QLQLSASYQCPQEEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLSEGLQPLGDYG
PNAKNGKRAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMGREPRL
DRTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLVKFRVRDDFFGMGKE
VGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGDLEAARQAKLRLENRIKDL
EEELRRVKSEAIVAHREPKEEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYK
ERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIH
YKSPTTAGFSQRRNHGMCQIAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDEGR
LQACGWSLPAKYKQLSPNGGQEDTRVKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWKP
SEDDSGNGVKPPPGCDPLTCDRDVEGETQSNHSSPERRKAKELPEAEPPSSRVWILTSTL
TTSKVVIIDASQPGAVVDQFTVCNAHVLCISSIPAASDGDYPPGEIFLDSDVNPEDSGAD
GVLAGITLVGCATRCNVPRSACSSRGDTPVLDKGQGEVAVVANGKVNPSQSMEEATEATE
VPDSGPSEADAGAVRPGPLTEHVFTDPAPTPPPSAQPDSENGPEADVSGMQPEPEPSGDP
TGATSSAAPTMWLGAQNGWLYVHSAVANWKKRLHSIKLKDSVLSLVHVKGRVLVALADGT
LAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVHDRVWCGYKNKVHVIQPKTMQIEKS
FDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKL
GFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARP
GGVIHVYGDDSSDKSASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDS
PSEGPGPTAPAADAEAQKLRNVLVLSGGEGYIDFRIGDGEDDEPEEGAGDMSQVKPMLSK
AERSHIIVWQVSYTPE
Download sequence
Identical sequences ENSSSCP00000008562 ENSSSCP00000008562 9823.ENSSSCP00000008562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]