SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008577 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008577
Domain Number 1 Region: 11-271
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.17e-81
Family Eukaryotic proteases 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008577   Gene: ENSSSCG00000008032   Transcript: ENSSSCT00000008801
Sequence length 277
Comment pep:known chromosome:Sscrofa10.2:3:41925392:41927412:-1 gene:ENSSSCG00000008032 transcript:ENSSSCT00000008801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLLFLTLPCLGGSVPVTPGRGPRHELVGIVGGHDVSTWKYPWQVSLRSYRAKLGRWMH
HCGGSLVHPQWVLTAAHCVDSHNLKPQDVRVQVGQLKLYDGDQLTKVKQIIRHPKYLGFA
KGGADIALLQLEAPLTLSARVNVVGTPSATLKVPKGKRCSVTGWGNIKHNLSLPPPYHLQ
EVEVPIVANKVCNKHYRTGPNSKPIKADMLCAGSKGLDSCQGDSGGPLMCSWNGTWVQVG
IVSWGRGCGLHNFPGVYIRVMSYVSWIYQYVPRSPGP
Download sequence
Identical sequences ENSSSCP00000008577 9823.ENSSSCP00000008577 ENSSSCP00000008577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]