SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008591 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008591
Domain Number 1 Region: 9-324
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.67e-58
Family Quinoprotein alcohol dehydrogenase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008591   Gene: ENSSSCG00000008044   Transcript: ENSSSCT00000008815
Sequence length 330
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:42386685:42400877:1 gene:ENSSSCG00000008044 transcript:ENSSSCT00000008815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTMNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSAQQVNALEITPDRSM
IAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRS
RNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSA
HIDPDASYMAAVNSTGNCFVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLA
TCSADQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGDSQYIVTASSDNLARL
WCVETGEIKREYGGHQKAVVCLAFNDSVLG
Download sequence
Identical sequences ENSSSCP00000008591 ENSSSCP00000008591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]