SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008611 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008611
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.9e-85
Family Eukaryotic proteases 0.0000712
Further Details:      
 
Domain Number 2 Region: 374-632
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.85e-85
Family Eukaryotic proteases 0.0000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008611   Gene: ENSSSCG00000008062   Transcript: ENSSSCT00000008835
Sequence length 632
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:42781549:42849126:-1 gene:ENSSSCG00000008062 transcript:ENSSSCT00000008835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPETHPAPRGRCLWILTALLLLAAPAVPDAAKTTGPPACGKPQQLNRIVGGEDSMDAE
WPWVVSIQKNGTHHCAGSLLTSHWVVTAAHCFKGLNKLAQFSVLLGAWQLGNPGPRSQEV
GIARVQPHPVYSWKEGSRADIALVHLERSIQFSERVLPICLPDSSVRLPPGTDCWIAGWG
SIHDGVPLPRPQTLQKLKVPIIDSGICSRLYWRGTGEGAVTEDMLCAGYLEGQRDACLGD
SGGPLMCQVEGTWLLAGVISWGEGCAERNRPGVYISLAAHRSWVQRIVATEHTWKIHHPV
TTPKACTTHRSFISSARSAFSSSSAPREHEAAPRPARPAASPSPRGSPPKSGSDQSSNKG
SQRAPSSSTGQSLPIVATSPAPPVCGRQRTLNRLVGGQDALEGEWPWQVSIQRNGSHFCG
GSLITEQWVLTAAHCFSNTSQTSLYQVLLGARQLVKPGPHAVYVQVKRVERNPLYQGMAS
SADVALVELAAPVTFTDYILPVCVPDPSVAFETGLRCWVTGWGSPSEQERLPNPRVLQKL
AVPVIDTPMCDRLYRTDAEESGFQPKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVGQS
WLQAGVISWGEGCARRNRPGVYIRVTSHHDWI
Download sequence
Identical sequences ENSSSCP00000008611 ENSSSCP00000008611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]