SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008612 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008612
Domain Number 1 Region: 40-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.25e-81
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008612   Gene: ENSSSCG00000008063   Transcript: ENSSSCT00000008836
Sequence length 323
Comment pep:novel chromosome:Sscrofa10.2:3:40647313:40653220:-1 gene:ENSSSCG00000008063 transcript:ENSSSCT00000008836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQAPQGLLLLFLFPLLPPGGASAGSLHSPAQPGVRLSIPGPCGLRGIQSRVVGGKDSE
LGRWPWQGSLRWNKVHLCGASLLNRRWVLSAAHCFQESANPNEWTVQFGELTSSPSFWSL
RAYLHRYRVQDIVLYSERVMPSRNDIALLRLASSVTYSKHIQPVCILASSSEFQNQTDCW
VTGWGHIREKKPALPPPYALQEGQVSIINKSRCSFLFRQPIYRSSTRDAMICAGSEDGSR
DTCRGDSGGPLACKKKGLWIQIGIVSWGVGCGRPNRPGVYTNVSSYFNWIQKLVAHSTPR
PGASQLLLSCLPLLWAPPLLQLV
Download sequence
Identical sequences ENSSSCP00000008612 ENSSSCP00000008612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]