SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008722 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008722
Domain Number 1 Region: 248-351
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.15e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 93-150
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000183
Family Heme-binding PAS domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008722   Gene: ENSSSCG00000008171   Transcript: ENSSSCT00000008948
Sequence length 796
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:55844996:56034828:-1 gene:ENSSSCG00000008171 transcript:ENSSSCT00000008948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSILYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKMLSSHMLVTDSPSPEYLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNEPSPSCNGFDSALSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYAEVRVER
RQELALEDPPLEAVHPSALKDKGSSLEPQQHFNALDVGTAGLNTSHSPSASSRSSHKSSR
TAMSEPPSTPSKLRSDTSTTALPRSAPELPGPGLNQAAPMPAPLPAPSSCDLTQQLLPQT
VLQSSPAPMAQFSAQLSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDSNVQ
MFLQQPAVSLSFNSAQQRSGPGPQPQLVASPQLPGQMAPAQATGQHLLRESSVIAIQGPK
PVRGSQMMQGNSLTPQFSSTAAVLPPALSLTTPASTSQDASQCQPSPDFSHDRQLRLLLS
QPIQPMMPGSCDARQPSEVGRAARQVKYPQSQAVFQNPDVHTTSSSASTPVLLMGLHPSF
AASQPSPLKPAQTQQQPHFLQVQAPTSLHSERQDSLLLSTYSPQPGTLGYPPPPAARPTR
RVSSLAESSGLQQPPR
Download sequence
Identical sequences F1STF9
ENSSSCP00000008722 XP_020942826.1.46622 XP_020942827.1.46622 XP_020942828.1.46622 ENSSSCP00000008722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]