SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008792 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008792
Domain Number 1 Region: 104-198
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-22
Family Zf-UBP 0.0044
Further Details:      
 
Domain Number 2 Region: 216-316
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.55e-16
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008792   Gene: ENSSSCG00000008235   Transcript: ENSSSCT00000009018
Sequence length 325
Comment pep:novel chromosome:Sscrofa10.2:3:62064531:62080280:1 gene:ENSSSCG00000008235 transcript:ENSSSCT00000009018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRSKRESRGSTRGKRESESRSSSARVKRERDRERETEAPSSRSSPVRVKREVEPASAR
EAPAPVIPAVRVKRERDVDEDSEPEREVRAKNGRLDSEDQRSRHCPYLDTINRSVLDFDF
EKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYE
IIDSSLEDITYVLKPTFTKQQIANLEKQVKFSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEML
QAVVLCSKKTFQITKQGKEGVIHVF
Download sequence
Identical sequences ENSSSCP00000008792 ENSSSCP00000008792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]