SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008947 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008947
Domain Number 1 Region: 1890-2269
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.3e-85
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000508
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008947
Domain Number - Region: 2331-2435,2563-2695,2767-2814
Classification Level Classification E-value
Superfamily ARM repeat 0.000125
Family Armadillo repeat 0.057
Further Details:      
 
Domain Number - Region: 1466-1740,1805-1855,2243-2268,2322-2500
Classification Level Classification E-value
Superfamily ARM repeat 0.0147
Family MIF4G domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008947   Gene: ENSSSCG00000008382   Transcript: ENSSSCT00000009178
Sequence length 2974
Comment pep:novel chromosome:Sscrofa10.2:3:84252665:84513413:1 gene:ENSSSCG00000008382 transcript:ENSSSCT00000009178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQNVCHLCLVLEKVSDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFNQ
VVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEQLNIERECNEGSTERQKS
VEKKSNSTKICNLTEEESSKGSDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAYKHNTHP
TIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFLI
AHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTVK
EPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSI
AKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKHC
SRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPGVHTEQTLYLASMLIKALWNNALAAKAQ
LSKQSSFASLLNTNLPIGNKKEEEELRRAAPSPWSPAASPQSSDNSDTHQSGGSDIEMDE
QLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQS
AGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICLGDSQGP
SERSGTSNGTGKDLVFNTESLPSVDNRIRMLDACSHSEDPEHDISGEMNAAHIAQASQES
CITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHHDGHMVDDMLSADDVSCSSSQ
VSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHKH
QFNSNAVTDINLDNVCKKGNTLLWDIVQDDDAVNLSEGLINEAEKLLCSLVCWFTDRQIR
MRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDN
LVYYIQGVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVE
DSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLA
RLATSAYDGGSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFIS
KCMESLMIASSSLEQESHSSLTVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHL
KALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQLQ
EFGQSSRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDMQMVFVSLGAPRRERK
GEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPSGKVAVEDSESLRC
EELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISDEQNNDAPNWKELLKIKSAHKLLYA
LEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENSKNSWSCKFVAAGGLQQLLEI
FNSGILEPKEQESWTVWQLDCLACLLKLICQFAVDPSDLDLAYHDVFAWSGIAESHRKRT
WPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDHR
SRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLKKLTLLIPETAVRHESCNGLYKL
SLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEPMLKPGCKEYFWLLCK
LIDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNIEDDGLTGLLRLATSVIKH
KPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENYR
LIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEARQ
AVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMT
EFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKN
IYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMK
EKVNTHFSFPLRLDMTPYTEDFLMGKSDRKEGFKEVGDHSKDTESYEYDLIGVTVHTGTA
DGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKF
MDFSFEKTHSAYMLFYKRMEPEEENGKEYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYF
GFMWQLCSCIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQ
AACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDG
SDDMDASVEDIGGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFL
LSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIAL
VALLVEQSRSERHLTLSQTDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRL
AEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNPS
QCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQM
FRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMT
YCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCADCPENIRLIV
QNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQW
AFKNLTPHASQYPGAVEELFNLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRS
CWTTLIRLFVILSQSTQDKYSLFTVFSNRGLLLL
Download sequence
Identical sequences ENSSSCP00000008947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]