SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008984 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008984
Domain Number 1 Region: 9-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.59e-34
Family Laminin G-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000008984
Domain Number - Region: 225-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000604
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008984   Gene: ENSSSCG00000008418   Transcript: ENSSSCT00000009218
Sequence length 257
Comment pep:novel chromosome:Sscrofa10.2:3:95389252:95546928:1 gene:ENSSSCG00000008418 transcript:ENSSSCT00000009218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTALLQRGGCFLLCLSLLLLGCWAELGNGLEFPGAEGQWTRFPKWNACCESEMSFQLKT
RSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIR
RQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPF
KGWIRDVRVNSSQALPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQ
AVCDCSRTGFRGKDCSQ
Download sequence
Identical sequences 9823.ENSSSCP00000008984 ENSSSCP00000008984 ENSSSCP00000008984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]