SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009011 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009011
Domain Number 1 Region: 236-338
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.86e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 87-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000115
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 3-64
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000135
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009011   Gene: ENSSSCG00000008443   Transcript: ENSSSCT00000009245
Sequence length 863
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:100173612:100213334:1 gene:ENSSSCG00000008443 transcript:ENSSSCT00000009245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHK
LLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTG
HSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSA
TWKVLHCTGQVKVYNNCPPHSSLCGCKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRH
SMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYR
MLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESPFKPHLM
AMNSIFDNSGKVPVSEKSNFLFTKLKEEPEELAQLAPTAGDTIISLDFGNPTFEESSAYG
KAILPPGQQWAGELRSHGAHSEAGSLPAFTVPQAAAPGSTTPSATSSSSCSTPSSPGDYY
TSLSDDLKIEAIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEE
SLLPENPQPTPQHCFSTMTNIFQPLAPGASHSPFLLDKYQQQLESKKMESEQRPVSLIFF
DSGSKVSLPPCCGQTCTPLSSMGGRSNTQWPPDPPLHLGPTKWPVEDQHTEPLGTSPLGP
PIATPHLSMFKKRSAKGFGPQGPDVMSPAMVALSNKLKLKRQLEYEEEQAFQDMSGGDPP
GSSASQLMWKRMKSLRSGGNCPLMPDKLLSANIPTDKFIQTPMRGLSQPLRHLAPPQPPS
AVSPREDAKGSFPPQCYAPQYQDYSLPAAHKVSGMASRLLRPSFEAYLLPELTRYDCEVN
VPVPGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences ENSSSCP00000009011 ENSSSCP00000009011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]