SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009070 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009070
Domain Number 1 Region: 657-720
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000104
Family VWC domain 0.006
Further Details:      
 
Domain Number 2 Region: 243-303
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000146
Family VWC domain 0.01
Further Details:      
 
Domain Number 3 Region: 521-578
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000931
Family VWC domain 0.013
Further Details:      
 
Domain Number 4 Region: 162-235
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000126
Family VWC domain 0.0035
Further Details:      
 
Domain Number 5 Region: 598-651
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000126
Family VWC domain 0.0077
Further Details:      
 
Domain Number 6 Region: 448-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000188
Family VWC domain 0.0053
Further Details:      
 
Domain Number 7 Region: 408-437
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000164
Family Huristasin-like 0.0079
Further Details:      
 
Domain Number 8 Region: 378-407
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000419
Family Huristasin-like 0.0049
Further Details:      
 
Domain Number 9 Region: 352-378
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000628
Family Huristasin-like 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009070
Domain Number - Region: 315-343
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000872
Family Huristasin-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009070   Gene: ENSSSCG00000008504   Transcript: ENSSSCT00000009306
Sequence length 880
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:110256208:110477211:-1 gene:ENSSSCG00000008504 transcript:ENSSSCT00000009306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLPSRCVCDPAGCL
RKVCQPGYLNILVSKASGKPGECCDLYECKPVFSVDCSTVECPSVQQAVCPLDSYETQVR
LTADGCCTLPTRCECLSGLCGFPVCEVGSTPRIVSRGDGTPGKCCDVFECVNETKPACVF
NNVEYSDGDMFRMDNCRFCRCQGGVSICFTAQCGELNCERYYVPEGECCPVCEDPVYPFN
NPAGCYANGQIRAHGDRWREDDCTFCQCINGEPHCVATACGQSCMNPVKVPGECCPVCEE
PTYITIDPPACGELSNCTLTEKDCIYGFKLDHNGCRTCQCKNREELCTGLKRGCTLDCPF
GFLTDAHNCEICQCRPRPKKCRPIICDKYCPFGYLKNKHGCDICRCKKCPELPCSKICPL
GFQQDSHGCLICKCREVPASAGPPILSGTCLSMDGHHHKNEESWHDGCRECYCHNGREMC
ALITCPVPACGNPTIHPGQCCPSCSDDFVVQKPELSTPSICHAPGGEYFVEGETWHIDSC
TQCTCHSGRVLCETEVCPPLLCQNPTRTQDSCCPQCPDEPLQPSSSHNDSVPSYCKNDEG
DIFLAAESWKPDVCTSCVCLDSVISCFSESCPSVSCERPVLRKGQCCPYCIVEDTIPKKV
LCHFSGKAYADEERWDIDSCTHCYCLQGQTLCSTVSCPPLPCVEPINVEGSCCPMCPEMY
VPEPTNIPIEKTNHRGEIDLEVPLWPTPSENDIIHLPKDMGHLQVDYRDNNRLHSGEDSS
LDSIASVVVPIIIGLSIIIAFLFINQKKQWIPLLCWYQTPTKPSSLNNHLVSVDCKKGAR
VQVDSSQRMLRIAEPDARLSGFYSMQRQNHLQADNFYQTV
Download sequence
Identical sequences ENSSSCP00000009070 ENSSSCP00000009070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]