SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009174 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009174
Domain Number 1 Region: 56-265
Classification Level Classification E-value
Superfamily vWA-like 2.92e-55
Family Integrin A (or I) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 328-434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000479
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 268-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009174
Domain Number - Region: 444-470
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00051
Family Chicken cartilage matrix protein 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009174   Gene: ENSSSCG00000008603   Transcript: ENSSSCT00000009414
Sequence length 486
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:126216875:126236879:1 gene:ENSSSCG00000008603 transcript:ENSSSCT00000009414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTKPAMPRYLPALLLLLWPLLLLLPAAADPSPLARPGFRRLGTRGPGGSPGRRPAAAAPT
HAPYSGAGQPGRARGAGICKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDNLDIGAE
DTRVAVVNYASTVKIEFHLQTHSDKQALKRAVARIAPLSTGTMSGLAIQTAMDEAFTVEA
GARGPNSNIPKVAIIVTDGRPQDQVNEVAARARASGIELYAVGVDRADMESLRLMASEPL
DEHVFYVETYGVIEKLSSRFQETFCALDPCLLGTHQCQHVCISDGEGKHHCECSQGYSLN
ADKKTCSAIDKCALNTHGCEHICVNDRTGSYHCECYEGYTLNEDRKTCSARDQCALGTHG
CQHICVNDGAGSHHCECYEGYILNEDKKTCSVRNKCALGSHGCQHICVNDGAGAYHCECY
TGYTLNEDKKTCSAIEEARRLISTEDACACEATLAFQDKVSSYLQRLNSKHILSKLQANE
YGQIHR
Download sequence
Identical sequences ENSSSCP00000009174 ENSSSCP00000009174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]