SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009188 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009188
Domain Number 1 Region: 282-448,489-623
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-45
Family Tandem AAA-ATPase domain 0.00047
Further Details:      
 
Domain Number 2 Region: 55-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-35
Family SPRY domain 0.003
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000121
Family Tandem AAA-ATPase domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009188   Gene: ENSSSCG00000008619   Transcript: ENSSSCT00000009430
Sequence length 689
Comment pep:novel chromosome:Sscrofa10.2:3:130448198:130480756:1 gene:ENSSSCG00000008619 transcript:ENSSSCT00000009430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYE
TLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFDPAIGSDGLCCQSREVKEWHGCRA
TKGLTKGKHYYEVSCHDQGLCRVGWSSMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGE
EFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGE
EEFKFPPKDGFVALSKASDSFVVKSQHSGNAQVAQTKFLPNAPKALIVEPSRELAEQTLN
NIKQFKKYIDNPKLRELLIIGGVAARDQLSVLDNGVSCTLIFKKNLLQLCLSPKLNLSPV
LCLMLGAEDGLLSQGYSDFINRIHNQIPQITSDGKRLQVIVCSATLHSFDVKKLSEKIMH
FPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKNHIRTDEVHAKDNTRPGANSPEM
WSEAIKILKGEYTVRAIKEHKMDQAIIFCRTKIDCDNLEQYFMQQGGGPDKKGHQFSCVC
LHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIG
RVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEE
HLNCTIPQVEPEIKVPVDEFDVKVTYGQK
Download sequence
Identical sequences ENSSSCP00000009188 ENSSSCP00000009188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]