SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009227 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009227
Domain Number 1 Region: 633-1212
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.65e-201
Family Myeloperoxidase-like 0.000000000474
Further Details:      
 
Domain Number 2 Region: 3-110
Classification Level Classification E-value
Superfamily L domain-like 3.95e-25
Family Ngr ectodomain-like 0.0063
Further Details:      
 
Domain Number 3 Region: 130-212
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 1312-1370
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000146
Family VWC domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009227
Domain Number - Region: 342-388,441-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000999
Family V set domains (antibody variable domain-like) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009227   Gene: ENSSSCG00000008655   Transcript: ENSSSCT00000009470
Sequence length 1377
Comment pep:novel chromosome:Sscrofa10.2:3:142094003:142181677:-1 gene:ENSSSCG00000008655 transcript:ENSSSCT00000009470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSYLYKNEIQSIDRQAFQGLASLEQLYLHFIQIETLDPESFQHLPKLERLFLHNNRITYL
VPGTFNHLESMKRLRLDSNALRCDCEILWLADLLKTYARSGNAQAAATCEYPRRIQGRSV
ATITPEELDCERPRITSEPQDADVTLGNTVFFTCRAEGNPKPEIIWLRNNNELSMAADSR
LNLLDDGTLMIQNTREADQGVYQCMAKKVAGEELAAKKHDILLRFLGKRPHRAVLTLTPE
LSGATGSWQVLEASATSSPLCQETVVPSPRGPLPTDPSTTVTPVGLGQGAGPRGPSGEVT
ALGQNSVRKIHFLTVQLNYATFSARVGGKGSGILPPHTAAESCKARGSPCSPKVYWERKG
GGKFEARSSSLFLASAEGRLSDLGIVLHTFGEFSSKLCTLLTSAKVHLHLSLVFRATFLW
ISRTMDVFTQVPLARNTLTPCSCQPGEPQPQRVLLRAGVKTFDEPLFYSPDPFIKLKDTH
FKDKGEFRCFANLEVGSQGSGVLLRVRGPSTPRHRKPFKPQLIAKAAARLSRSPAHQLQT
HLRPRQPFSPQMKALQLLLMGHDPGKDGTGQYASIILYNTIQLLNEKIAKAEPSPAFRPG
YHYNDLVSPQYLGLIANLSGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASMTA
FERLLKAVYENGFNTPRGIDPSRRYHGHPLPVPRLVSTALIGTEAVTPDEQFTHMLMQWG
QFLDHDLDSTVVALSQASFSDGQHCSATCSSDPPCFSVAIPPDDPRARSGARCMFFVRSS
PVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSSEHEARAIRDLASQRGLLRQGIVQ
RSGKPLLPFAAGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRVAAEL
LALNPHWDGDTIYHEARKVVGAQVQHITYQHWLPKVLGEAGMKMLGEYRGYDPGVNAGIV
NAFATAAFRFGHTLINPVLQRLDENFQPIAHGHVPLHKAFFSPFRIVNEGGIDPLLRGLI
GVAGKMRVPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDFRAYCNLSAA
HTFEGLKNEIKNPEIREKLRRVVRSPLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFKR
LRDGDRLWYENPGVFSPAQLTQIKQTSLARILCDNADNITRVQRDVFRVAEFPHGYSSCA
EVPRMDLRVWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDGPAREAGPAKMPSRGKQ
PGMRLSNATATSLERPQVPGTGDVREFVLEVQKTIAELRRQIKTLESRLSTECVDADGEP
HADGTQWKRDPCTLCGCRDGQVTCFVETCQPADCPAPVRVGGACCPVCPGASAGRGP
Download sequence
Identical sequences ENSSSCP00000009227 ENSSSCP00000009227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]