SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009298 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009298
Domain Number 1 Region: 112-318
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.28e-54
Family Prokaryotic proteases 0.000000442
Further Details:      
 
Domain Number 2 Region: 327-423
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-18
Family HtrA-like serine proteases 0.0019
Further Details:      
 
Domain Number 3 Region: 1-66
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.0043
Further Details:      
 
Domain Number 4 Region: 52-100
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000056
Family Ovomucoid domain III-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009298   Gene: ENSSSCG00000008723   Transcript: ENSSSCT00000009543
Sequence length 425
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:4456176:4482055:-1 gene:ENSSSCG00000008723 transcript:ENSSSCT00000009543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDVSRCPSPRCRGGYVPDLCNCCLVCAAVEGEPCVRPVDSPCGESLECARGVCRCRWAHA
VCGTDGHTYANVCALQAASRRALQLSGTPVRQLQKGACPSGLHQLTSPRYKFNFIADVVE
KIAPAVVHIELFLRHPLFGRNVPLSSGSGFVMSESGLIVTNAHVVSSTNAVTGRQQLKVQ
LQNGDTYEATIKDIDKKSDIATIRIRPKKKLPALLLGHSADLRPGEFVVAIGSPFALQNT
VTTGIVSTAQRDGRELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGI
SFAIPSDRIARFLTEFQDKQGKDWKKRFIGIRMRTITPSLVEELKASNPDFPAVSSGIYV
QEVVPNSPSQRGGIQDGDIVVKVNGRPLADSSELQEAVLTESPLLLEVRRGNDDLLFSIA
PEVVP
Download sequence
Identical sequences ENSSSCP00000009298 ENSSSCP00000009298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]