SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009320 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009320
Domain Number 1 Region: 39-250
Classification Level Classification E-value
Superfamily N-(deoxy)ribosyltransferase-like 2.17e-86
Family ADP ribosyl cyclase-like 0.00000000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009320   Gene: ENSSSCG00000028359   Transcript: ENSSSCT00000009566
Sequence length 254
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:10659177:10677544:1 gene:ENSSSCG00000028359 transcript:ENSSSCT00000009566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGCARSGLRLPALLLLLQFLLQPRTGGAAGPAAARWSGPGTVPHLQSIFLGRCAEFV
ALLRPELRDKNCTAIWEAFKVVLDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENNHLL
VTSYTENGRRFVSLCDVLYGKVGDFLTWCRQKNDSGLDYQSCPTSNDCENNPVDSYWKSA
SIQYAKESSGVIYVMLNGSEPTGAYPVKGFFADFEVPNLQKDKVTRIEIWVMHEIGGPKL
ESCGEGSVKVCGDR
Download sequence
Identical sequences ENSSSCP00000009320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]