SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009325 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009325
Domain Number 1 Region: 22-188,269-383
Classification Level Classification E-value
Superfamily L domain-like 8.26e-51
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 659-849
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-41
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 511-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000524
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 587-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 5 Region: 428-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000225
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 6 Region: 471-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 7 Region: 550-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000676
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 845-886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000742
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009325
Domain Number - Region: 936-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 888-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000409
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009325   Gene: ENSSSCG00000008749   Transcript: ENSSSCT00000009572
Sequence length 1045
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:15355493:15443176:-1 gene:ENSSSCG00000008749 transcript:ENSSSCT00000009572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLSKIPDHIPQYTAELRLNNNEFTV
LEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQYKMFKGLES
LKTLDVRSNRISCVGNDSFIGLSSVRLLSLYDNQITTIAPGAFDTLHSLSTLNLLANPFN
CNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRC
PTECTCLDTVVRCSNKALKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNN
RISTLSNQSFSNMTQLLTLILSYNRLRCLPPRTFDGLKSLRLLSLHGNDISVVPEGAFND
LSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTC
QGPVDVSILAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDVPIHACISNPCK
HGGTCHLKEGEKDGFWCICADGFEGENCEINVDDCEDNDCENNSTCVDGINNYTCLCPPE
YTGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKNRCDCTPGYIGEHCDIDFDDCQDNKC
KNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIIRLNEPIC
QCLPGYQGEKCEKLVSVNFVNKESYLQIPSAKVRPQTNITLQIATDEDSGILLYKGDKDH
IAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGSPKIIT
NLSKQSTLNFDSPLYVGGMPGKNNVAAALRQAPGHNGTSFHGCIRNLYINSELQDFRKVP
MQTGILPGCEPCHKKVCAHGTCQPSSQSGFTCECEEGWTGPLCDQRTNDPCLGNKCVHGT
CLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAINCKHGKCRLSGLGQPYCECSSGYTG
DSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCRPLRSKRRKYSF
ECTDGSSFVDEVEKVVKCGCNHCTS
Download sequence
Identical sequences ENSSSCP00000009325 ENSSSCP00000009325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]