SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009452 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009452
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-19
Family RING finger domain, C3HC4 0.0045
Further Details:      
 
Domain Number 2 Region: 92-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000147
Family B-box zinc-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 287-341
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000218
Family SPRY domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009452
Domain Number - Region: 148-241
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.068
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009452   Gene: ENSSSCG00000021928   Transcript: ENSSSCT00000009701
Sequence length 341
Comment pep:novel chromosome:Sscrofa10.2:8:46178462:46179637:1 gene:ENSSSCG00000021928 transcript:ENSSSCT00000009701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAASLAQLQAEASCPICLDYLRDPVTTDCGHNFCHSCLLQRWEGLQGDFPCPVCLQHC
PDRSLRRNTQLCHMVDVVKQLPNTRRKRKRQEEKPLCEKHHQVLSLFCEEDLELLCPQCK
ISSHHGGHLVVPMELAAACHRKKLKGFIKFLTKRLEEVDEALEIQTSKAYHLMEEVANQR
NKLQVEVEHMKHFLGKMHDDIHFRLLTEEKGVQDEIIVKNNQISDHISMLKTLLDDINDK
CVQPDTNLLMGIEKIHSTFENLESPAGFSYELNKEIFTLPPQYFGLHKMISTFQENLTLD
AKTAHGSLILSQDGKTATFQRRNVPIPPTPDNGCWKIQVWA
Download sequence
Identical sequences ENSSSCP00000009452 ENSSSCP00000009452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]