SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009453 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009453
Domain Number 1 Region: 285-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-42
Family SPRY domain 0.0000788
Further Details:      
 
Domain Number 2 Region: 4-76
Classification Level Classification E-value
Superfamily RING/U-box 4.99e-19
Family RING finger domain, C3HC4 0.0045
Further Details:      
 
Domain Number 3 Region: 90-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000168
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009453   Gene: ENSSSCG00000008862   Transcript: ENSSSCT00000009702
Sequence length 440
Comment pep:novel chromosome:Sscrofa10.2:8:46043239:46044558:-1 gene:ENSSSCG00000008862 transcript:ENSSSCT00000009702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASLAQLQAEASCPICLDYLRDPVTTDCGHNFCHSCLLQRWEGLQGDFPCPVCLQHCPDR
SLRRNTQLCHMVDVVKQLPNTEGEGKQQEEKPLCEKHHQVLSLFCEEDLELLCPQCQVSC
DHQDHHLVPMEQAAACHRKRLKGSIEHLTKQFKEANKALEMQVSKSFELVRKVENQRRDL
HSEVEYIKHFLGIEHDEICVRLLKEEKRVQDKIIGTNHKISGHESRLKILLRKITDKCAQ
PDVDLLMGIEKIHSTFENLESPAGFSYELNKEIFTLPPQYFGLHKMISTFQEYLTLDAET
AHGSLILSQDGKTATFQSLEPNHVHNPKAFTSHPAVLGSEGFDAGRHFWQVEGRGLGELS
LGVCKESFPRNVPIPPTPDNGCWKIQVWATTPDTGVSGNSCHIGVFLDYELGEVSFYNLY
DRSNLYTFSAIFTGKLMPYF
Download sequence
Identical sequences 9823.ENSSSCP00000009453 ENSSSCP00000009453 ENSSSCP00000009453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]