SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009454 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009454
Domain Number 1 Region: 253-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-49
Family SPRY domain 0.0000608
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 1.21e-19
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 90-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000198
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009454   Gene: ENSSSCG00000008863   Transcript: ENSSSCT00000009703
Sequence length 434
Comment pep:novel chromosome:Sscrofa10.2:8:46150254:46151555:-1 gene:ENSSSCG00000008863 transcript:ENSSSCT00000009703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAALAGLQAEAKCPICLDSLHDPVTIQCGHNFCRRCIQRSWAELEDTFPCPMCRHPC
LEPHVRSNTQLGRMIEVARLLHSSRSSSKMSQQPHLCEWHNQVLSLFCENDLEVLCPLCA
QTPSHQGHVMRSVAEAAADHLQKVSSYVEPLKRQVAETQGLLAMQDIKLLELQEQVQHRQ
LELASEVRQMSRAVDHEQELVLARLVQEEHNIHEQLVTNIAAFSGHIWELWGLLQEMREQ
SCSFSPQYSVLQKIAQKFTEDVILDPETAHPNLLVSEDRKSATFMRMRQMVLKAGRFRLE
PAVLGSVGFGHGRRYWEVRVDGATWAVGVCMDTAPRARSRHMEGQSCYWTVGQRRGDYQA
WGPAGILPLELKEDPCGIGVYLDYELGVISFYNLKDRSHIHSFTDSFSGVLKPYFCVGCD
SRPRTLSSVIEHEG
Download sequence
Identical sequences ENSSSCP00000009454 ENSSSCP00000009454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]