SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009455 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009455
Domain Number 1 Region: 288-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-43
Family SPRY domain 0.0000682
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 9.5e-20
Family RING finger domain, C3HC4 0.0043
Further Details:      
 
Domain Number 3 Region: 92-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000229
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009455
Domain Number - Region: 210-239
Classification Level Classification E-value
Superfamily Heterotrimerisation domain of extracellular hemoglobin linker subunits 0.0785
Family Heterotrimerisation domain of extracellular hemoglobin linker subunits 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009455   Gene: ENSSSCG00000030208   Transcript: ENSSSCT00000009704
Sequence length 460
Comment pep:novel chromosome:Sscrofa10.2:8:45990930:45992312:-1 gene:ENSSSCG00000030208 transcript:ENSSSCT00000009704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAASLAQLQAEASCPICLDYLQDPVTTDCGHNFCHSCILQRWEDLQGDFPCPVCLQHC
PDRSLRRNTQLCRMVDVVKQLPNTRRKRKRQEEKPLCEKHHQVLSLFCEEDLELLCPQCR
VSSDHCDHPLVPMEQAAACHRKRLKDSIERLTKHLEEAYKALEMQVSKSYELMWEVENQK
SKLQLEVEHMKHFLGKMHDDIHFRLLKEEKDVQDKMIEKNNQLSDHISMLKTLLDDINDK
CVQPDTNLLMGIEKIHSTFENLESPAGFSYELNKEIFTLPPQYFGLHKMISTFQDHLTLD
AETAHRSLVISQDGKTATFQTRGPNRARKSKAFTSHPSVLGSEGFDAGRHFWQVEGRGLG
EWSLGVCKESFPRNVPKPPTPDNGCWQIQVWATTPDTGVSGNSCHIGVFLDYELGEVSFY
NLYDRSNLYTFSAIFTGKLMPYFSVRPSSTSLKLRIVDEE
Download sequence
Identical sequences ENSSSCP00000009455 ENSSSCP00000009455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]