SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009456 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009456
Domain Number 1 Region: 288-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-44
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-20
Family RING finger domain, C3HC4 0.0049
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000458
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009456   Gene: ENSSSCG00000021125   Transcript: ENSSSCT00000009705
Sequence length 461
Comment pep:novel chromosome:Sscrofa10.2:8:46166029:46167414:1 gene:ENSSSCG00000021125 transcript:ENSSSCT00000009705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAASLAQLQAEASCPICLDYLQDPVTTDCGHNFCHSCLLQRWEGLQGDFPCPVCLQHC
PDRSLRRNTQLCHMVDVVKQLPNMEGEGKQQEEKALCLKHHQVLSLFCEEDLELLCPQCK
ISSHHGGHLVVPMEPAAACHRRRLKGSIEPLKEQHEVAKKALEMQVSKTFDLMREVQKQR
SKLQSEVEYMKHFLNKEHDAIHFRLLNNGKDVQDKIIESRNQISDHSSRLKSLLDEITKK
CLQRDLDLLMGIERIYSTYKNLESPAGFSYELKKEIFTLPPQYFGLHKMITTFQEYLTLD
AGTAHNSLFITKDRKTATFQRMKLNCFYNPQAFTSHPAVLGSEGFNAGRHFWQVEGRGLG
EWSLGVCKESFPRNVPIPPTPDNGCWKIQVRATTSGTGDLENSRRIGVFLDCELGEVSFY
NLIERSLLYSFSAIFTGKLMPYFSVGSSSTSVTLNLVEDEV
Download sequence
Identical sequences ENSSSCP00000009456 XP_013844751.1.46622 ENSSSCP00000009456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]