SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009458 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009458
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.07e-61
Family Papain-like 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009458   Gene: ENSSSCG00000008867   Transcript: ENSSSCT00000009707
Sequence length 194
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:46724245:46739145:-1 gene:ENSSSCG00000008867 transcript:ENSSSCT00000009707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCGGCWAFSVVSAVESAYAIKGQPLEVLSVQQVIDCSYNNYGCNGGSTLNALYWLNKTQV
KVVSDSEYPFKAQNGLCHYFSCSHSGVSIKDYSAYDFSGQEDEMAKTLLTLGPLIVIVDA
VSWQDYLGGIIQHHCSSGEANHAVLVTGFDKTGSTPYWIVRNSWGSAWGIDGYALVKMGG
NICGIADSVSAVFV
Download sequence
Identical sequences ENSSSCP00000009458 ENSSSCP00000009458 9823.ENSSSCP00000009458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]