SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009514 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009514
Domain Number 1 Region: 601-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-68
Family Protein kinases, catalytic subunit 0.00000000873
Further Details:      
 
Domain Number 2 Region: 2-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-67
Family Ephrin receptor ligand binding domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 288-491
Classification Level Classification E-value
Superfamily Fibronectin type III 2.21e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 219-290,326-341
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000224
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009514   Gene: ENSSSCG00000008919   Transcript: ENSSSCT00000009766
Sequence length 819
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:67246449:67540672:-1 gene:ENSSSCG00000008919 transcript:ENSSSCT00000009766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIE
LKFTLRDCNSLPGGLGTCKETFNMYYFESDGENGRNIKENQYIKIDTIAADESFTELDLG
DRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHLAVFPDTITG
ADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGF
FKASPHSQSCSKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSAPRNAISNVN
ETSVFLEWIPPADTGGRKDVSYYIACKKCSSHAGVCDECGGHVRYLPQQIGLKNTSVMMV
DLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKIAKNSISLSW
QEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQIRARTAAGYG
VFSRRFEFETIPVSVAASSDQSQIPIIAVSVTVGVILLAVVIGFLLSGSCCDCGCGRASS
LCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAK
EIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRDFLGEASIM
GQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGIAAGM
KYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTAPE
AIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDV
Download sequence
Identical sequences ENSSSCP00000009514 ENSSSCP00000009514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]