SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009525 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009525
Domain Number 1 Region: 197-432
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-83
Family Eukaryotic proteases 0.00026
Further Details:      
 
Domain Number 2 Region: 48-173
Classification Level Classification E-value
Superfamily SEA domain 2.62e-26
Family SEA domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009525   Gene: ENSSSCG00000008930   Transcript: ENSSSCT00000009778
Sequence length 437
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:70161196:70235238:-1 gene:ENSSSCG00000008930 transcript:ENSSSCT00000009778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAPVRYSEADYPRIDYQRREQFWDPIRLTLFILAIVAIIGIAIGIVTHFVVEDDNSFYY
LASFKVTNIKYKENYGMRTSRDFIERSHQIEKMMSRIFRNSSGEGRFIKSHVIKLSPEKN
GVNILMVLVFRYPSTDNTERIRKKIERILYQTMKTKQLPLTINKPSFTLTSIDRKKMRNL
LKSRCGIRMTSSYMPLLAFSSTERIVQGRKTSMEGEWPWQASLQLKGKGHQCGASLISNT
WMLTAAHCFRKNKDPSQWIVTFGTTITPPAVQRSVGKIIIHENYHQETNENDIALAQLAT
RVEFSNVVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPTQNHLRQARVETISTEVCNRK
DVYDGLVTSGMLCAGYMEGKIDACKGDSGGPLVYDNHDIWYLVGIVSWGQSCALPKKPGV
YTRVSRYRDWIALKTGI
Download sequence
Identical sequences ENSSSCP00000009525 ENSSSCP00000009525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]