SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009528 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009528
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-48
Family Eukaryotic proteases 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009528   Gene: ENSSSCG00000008933   Transcript: ENSSSCT00000009781
Sequence length 142
Comment pep:novel chromosome:Sscrofa10.2:8:70283693:70285804:-1 gene:ENSSSCG00000008933 transcript:ENSSSCT00000009781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTEKVLFKKDVHPVCLPEATQIFPPGEGVVVTGWGALAHNGEYPLLLQKAPVKIIDTNT
CNAEEAYNGMVKDTMLCAGYLEGNIDACQGDSGGPLVHPNSRNIWYLVGIVSWGEECGEV
NKPGVYIRVTSFRHWIASKTGV
Download sequence
Identical sequences ENSSSCP00000009528 ENSSSCP00000009528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]