SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009546 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009546
Domain Number 1 Region: 106-152
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 44-103
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000641
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009546   Gene: ENSSSCG00000008945   Transcript: ENSSSCT00000009799
Sequence length 338
Comment pep:known chromosome:Sscrofa10.2:8:72590937:72603071:-1 gene:ENSSSCG00000008945 transcript:ENSSSCT00000009799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFQYTKYGCRRKSDNKMVHRSFCEANKKPKPIRRMCNIQECTHPLWATEEWEHCTKTCGS
SGYQLRTVRCLQPLLDGTNRSVHSKYCLGERPESRRPCNRVPCPAQWKTGPWNECSVTCG
EGTEVRQVLCRVGDHCDGEKPESVRACQLPPCNDEPCLGDKSIFCQMEVLARYCSIPGYN
KLCCESCGKRSGTLPPPYLPEAAETHDDALFNPSDLPGSLVMPTSLVPHYSEAPAEKKSL
SRIFSVGRPNAYAAFRPDSKSDGANLLQRRAQPAESKTPRPASPPTRRGHLTSSPRMSAT
PFLAASDSIGASSQARTSKKDEKLIDKRRPLRSPTLER
Download sequence
Identical sequences 9823.ENSSSCP00000009546 ENSSSCP00000009546 ENSSSCP00000009546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]