SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009595 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009595
Domain Number 1 Region: 475-631
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.27e-30
Family Growth factor receptor domain 0.00044
Further Details:      
 
Domain Number 2 Region: 616-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.66e-30
Family Growth factor receptor domain 0.00026
Further Details:      
 
Domain Number 3 Region: 869-1027
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.52e-28
Family Growth factor receptor domain 0.00061
Further Details:      
 
Domain Number 4 Region: 2889-3022
Classification Level Classification E-value
Superfamily CalX-like 2.62e-25
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 5 Region: 3009-3153
Classification Level Classification E-value
Superfamily CalX-like 3.4e-25
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 6 Region: 2520-2641
Classification Level Classification E-value
Superfamily CalX-like 5.36e-25
Family CalX-beta domain 0.00082
Further Details:      
 
Domain Number 7 Region: 2766-2881
Classification Level Classification E-value
Superfamily CalX-like 3.92e-20
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 8 Region: 2641-2766
Classification Level Classification E-value
Superfamily CalX-like 1.01e-19
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 9 Region: 388-491
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.09e-18
Family Growth factor receptor domain 0.00096
Further Details:      
 
Domain Number 10 Region: 776-893
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.19e-16
Family Growth factor receptor domain 0.001
Further Details:      
 
Domain Number 11 Region: 113-184
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000377
Family VWC domain 0.03
Further Details:      
 
Domain Number 12 Region: 48-121
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000565
Family VWC domain 0.011
Further Details:      
 
Domain Number 13 Region: 186-247
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000091
Family VWC domain 0.024
Further Details:      
 
Domain Number 14 Region: 239-311
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.013
Further Details:      
 
Domain Number 15 Region: 333-388
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000439
Family VWC domain 0.011
Further Details:      
 
Domain Number 16 Region: 3-56
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000104
Family VWC domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009595
Domain Number - Region: 1013-1063
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0022
Family Growth factor receptor domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009595   Gene: ENSSSCG00000008991   Transcript: ENSSSCT00000009848
Sequence length 3985
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:77933776:78202799:1 gene:ENSSSCG00000008991 transcript:ENSSSCT00000009848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQDATVWKPDSCQNCRCHGDIVICKPAVCRNPQCALRSGGEVLQIPANQCCPECVPRTPG
SCHHENKIHAHGTEWTASPCGVCSCAHGEVQCTPRPCPPLLCGHQELEFIPEGSCCPVCV
GPGKPCSYEGRVFQDGEDWPLSRCAKCVCRNGVAQCFTAHCQPLFCKQDETLVRVPGKCC
PQCSSRSCSTASQVHEHGEQWSENACTTCICDQGEVRCHKQACPPLRCEKGQRRAQRHGQ
CCEDCVSPTGSCSHGGLMRYQDEMWKGSACEFCTCDRGQVTCQTGECAKVECGQGEDLIH
LDGKCCPECISRNGYCVYEEKPGLMSSNASNVKHIPDGEKWQDGPCKVCECRAAQVTCYE
PSCPPCPVATLAQVVKGQCCPDCTSVHCHPDCLTCSQSPDHCDLCQDSTKLLRNGRCVHS
CGLGFYQAGAFCLACQPQCSTCSSGLECSSCRPPLLMQHGQCVSTCGNGFYQDHHSCAAC
HESCAACWGPSEKHCLACRDPLLVLREGTCESSCGDGFYNKQGTCSACDQSCKSCGPRSP
RCLTCVEKTVLHDGKCISECPGGYYADATGRCRVCHNSCASCSGPRASHCTACTHPQALR
QGHCLPSCGEGFYPDHGVCKACHPSCLTCVGPEPSHCTQCMKPEEGLQVESLSGTNITAG
KCLLRCRAQLYLESTGLCEACHPSCLGCAGKSPQNCTACLPSHVLLDGQCLSQCPDGYFS
QEGSCTECHPTCRQCHGPLDSDCLSCHPHVPLAGGTCRTSCKEEQFLNLVGYCADCHPLC
QHCAADLHHTGSVCLRCQNARHLLLGDRCVPDCPSGYFVERGACKRCHSSCRTCHGRGPF
SCSSCDSNLVLSHLGTCSSTCFPGHYLGDNRACQPCDMHCRSCDSQASCTSCRDPNKVLL
FGDCQHESCAPQYYLDLSSKTCKECDWSCNACSGPLRTDCLQCMDGYVLQDGTCVEQCSP
SFYRDSGLCKSCGSHCLQCQGPHVCTRCEGPFLLLEARCVQECGKGYFADHANHKCTACP
RGCLQCSRKDRCHLCDHGFFLKSGLCVSSCVPGFSAHSSNETCAGKRHTPSLHVNGSLTL
AIGSMKPLDFFLLNVQDQDGRVEDLLFHVVSAPTNGQLVLSRNGKEVQLDKAGHFSWKDV
REKKVRFVHSKEKPRKGYFSLKISDQQFFSEPQLINIQAFSTQAPYVLRNEALHVNRGQR
GTLTTQLLDIRDDDNPQDVVVEVLDPPLHGQLLQTLQSPAAPIYQFRLDELSRGLLQYVH
DGSDSTSDVVVLQANDGHSIQNILFHVKTVPKNDGSLRLVANSMVWVPEGGMLQITNRIL
QAEAPGVSASEIIYKITQERPQFGEVVLLVNMPADSPADEGQHLPDGRTATPTSTFSQQD
INEGIVWYRHAGVPAQSDSFRFQVSSATEARAHLDSHMFNIAILPQTPQAPTRSPGASLH
LMAREDGLTVIQPHSLSFINSERPSGKIIYNITLPLHPNQGIIEHRDQPHSPVRYFTQED
INQGKIMYRPPPAAPHLQEIMAFSFDGLPESVKFHFTVSDGEHTSPEMALTIHLLRTDQH
PPVFQVKAPLIEVSPGGSASIGLQLVVRDTETAPENLFFELRKPPQHGTLMKYTAGFPGP
MAAGDTFTHEDVEKNVLQYVHDGSSAREDSMEITVTDGISATAVEVRVEVSLSQARGPRL
AAGASLSLTVAGKSTAVITRSHLAYVDDSSPDPEIWIQLKSLPMYGALLRTSGPEVEELS
EVSNFTMEDINNKNIRYSAAFETGGHLLTDSFHFSVSDMEHNRLDNQRFIITITPVEDPP
PVIAFADLITVDEGGRTPLSFHHFFAADDQDNLQGDTVIKLSALPKYGCIENTGTGDRFG
PGTTSDLEASFPIQDVLENYIYYFQGVHEGIEPTHDIFSFYVSDGSSRSEIQSINITIER
KNDEPPRMTLRPLGVQLPSGAVISNASLNLQDLDTPDNELIFVLTKKPGHGHLLLRQTAS
EPLENGKILAQGSSFTYQDVLAGLVGYMPAGPSVAVDEFQFSLTDGLHMDTGRLEIYTEL
LPTGDPLHLAVNRGLQLLAGSVAPITEQHLKVADTDSNDHQVTYILKEDPGAGRLQMLKQ
DDLAHISVKGPIRSFTQADLSQGLVEYHHGKGESGGSFAFKFDVVDGEGNKLVGQSFSIS
VLEDKSPPVITVNKGLVLDENSVKKITTLQLSATDKETKPAELIYTITRQPQLGHLEHTA
SPGTPIGSFTQADLASGNVQYVHSSEAEKHSDAFSFTLSDGVNEVTQTFHITLRPVDDSL
PVVQSLGMRVQEGLRKPITEFELKAVDADTEAESVTFRVVQPPRHGTIERTTNGQPFQPT
STFTMEDVYQNRVHYSHDGSNALKDWFTFTVADGTNPFFVIEEGGKEMVTAAAQQFWVDI
LPVDDGTPRIVTNLGLQWLEYVDGRATNLITKKELLTMDPDTEDLQLVYEITTGPKHGHV
ENKLQPGRAAATFTQEDVNLGLIRYVLHEEKIREMMDSFQFLVKDSKPNVVSDNIFHVQW
SLISFQYTSYNVSEKAGSVSVTVQRTGNLNQYAIVLCRTEQGTASSSSRVSSQPGQQDYV
EYAGQVQFDEREDTKSCTIVINDDDVFENVESFTVELSMPAYALLGEVTQAKVIISDPED
EPTLEFDKKTYRVNESAGFLFAPIERKGDSSSIVSVICYTVPKSAMGSSLYALESGSDFK
SRGMSAESLVIFGPGVTTSTCDVMLIDDSEYEEEEEFEIALADASDNARLGRVASAKVLI
TGPNDASTVALGSTAFTVSEDAGTVKIPVIRHGTDLSTFTSVWCATRPSDPASATPGVDY
VPSSRKVEFGPGVTEQYCTLTILDDTQYPVIEGLETFVVFLSSAQGAELTKPFQAVIAIN
DTFQDAHPVPSMQFAKELLLVKEKEGVLHVPIVRSGDLSYESSVRCYTQGHSAQVLEDFE
ERRNADSSRITFLKGEKMKNCTVYIHDDSMFEPEEQFRVYLSHPLGNHWSGARVGKNNVA
TVTISNDEDAPTIEFEEAAYQVREPSGPDATALLNIKVIRRGDQNRTSKVRCSTRDGSAQ
SGVDYYPKSRVLKFSPGVDHIFFKVEILSNEDREWHESFSVVLGPDDPVEAVLGDVTTAT
VTILDQEAAGSLILPAPPIVVTLADYDHVEEVTKEGVKKSPSPGYPLVCVTPCDPHFPRY
AVMKERCSEAGINQTSVQFSWEVAAPTDGNGARSPFETITDNTPFTSVNHMVLDSIYFSR
RFHVRCVAKAVDKVGHAGTPLRSNIVTIGTDSAICHTPVVAGTARGFQAQSFIATLKYLD
VKHKEHPNRIHISVQIPHQDGMLPLVSTMPLHNLHFLLSESIYRHQHVCSNLVTTRDLRG
ISEAGFLDNRVYDSTALGPGYDRPFQFDSSVREPKTIQLYKHLNLKSCVWTFDAYYDMTE
LIDVCGGSVTADFQVRDSAQSFLTVHVPLYVSYVYVTAPRGWASLEHHTEMEFSFFYDTV
LWRTGIQTDSVLSARLQIIRIYIREDGRLVIEFKTHAKFREIGQFVMEHHTLPDVKSFIL
TPDHLGGIEFDLQLLWSAQTFDSPYQLWRATSSYNRKDYSGEYTICLVPCTVPPTQPWAD
PGEKPLACTAHAPERFLIPIAFQQTNRPVPVVYSLNTEFQLCNNEKVFLMDPNTSDMSLA
EMDYKGAFSKGQILYGRVLWNPEQNLNSAYKLQLEKVYLCTGKDGYVPFFDPTGTIYNEG
PQYGCIQPNKHLKHRFLLLDRSQPEVTDKYFHDVPFEAHFASELPDFHVVSTMPGVDGFT
LKVDALYKVEAGHQWYLQVIYVIGPDTISGPRVQRSLTAPLRRPRRDLVDPSGWLTLDES
LIYDNEGDQVKNGTNMKSLNLEMQEPVTAASLSQTGASIGSALAAIMLLLLVFLVACFIT
RKCQKQRKKPPAADLGEEYPLNTKVEVPKRGADRVEKNVDRQYRTARNANVLGQPAGPYA
FKGATVKKLNLEVRVHNNLQDGTEV
Download sequence
Identical sequences ENSSSCP00000009595 ENSSSCP00000009595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]