SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009599 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000009599
Domain Number - Region: 39-74
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0618
Family NlpC/P60 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009599   Gene: ENSSSCG00000008995   Transcript: ENSSSCT00000009852
Sequence length 230
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:78710098:78717666:-1 gene:ENSSSCG00000008995 transcript:ENSSSCT00000009852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNPMLEAVSLVLEKLLLISNFRLFSSGAPGEDKTRNTFYEISSYLRGDVLEVPRTHLTH
YGIYLGDNRVAHMMPDILLALTDDKELTQKVVSNKRLILGVICRVASIRVDTVEDFAYGA
DILVNHLDRSLKKKALLNEEVARRAEKQLGLSSYSLLWNNCEHFVTYCRFGTAISPQADK
FCENVKIIIRDQRSVLASAVLGLASIVCLGLAPYTTLPAIFIPFCLWMAG
Download sequence
Identical sequences F1RYR6
ENSSSCP00000009599 ENSSSCP00000009599 XP_005666846.1.46622 XP_005666847.1.46622 9823.ENSSSCP00000009599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]