SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009655 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009655
Domain Number 1 Region: 485-580,756-902,945-985
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.02e-61
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009655
Domain Number - Region: 173-449
Classification Level Classification E-value
Superfamily ARM repeat 0.000892
Family Armadillo repeat 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009655   Gene: ENSSSCG00000009049   Transcript: ENSSSCT00000009910
Sequence length 1077
Comment pep:novel chromosome:Sscrofa10.2:8:89717750:89798021:-1 gene:ENSSSCG00000009049 transcript:ENSSSCT00000009910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGGGRSSCCSPNSPPSRVSPGTPRGCGCPLLTTWPWLCSVATMDKILEGLVSSSHPLPL
KRVIVRKVVESAENWLDEAQCEAMFDLTTRLILEGQDPFQRQVGHQVLEAYARYHRPEFE
SFFNKTFVLGLLQQGYHSLDRKDVAILDYIHNGLKLIMSCPSVLDLFSLLQVEVHRMVCE
RPEPHLCARLSDLLSDFVQCIPKGKLSITFCQQLVRTIGHFQCVSTQEKELREYVSQVTK
VSNLLQNIWKGEPSTLLPSLQEVFASISSTETDASFEPSVALASLVQHIPLQMITVLIRS
LTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAVQKFTILIDVTLLKIE
LVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHVVNLVHSFRSDGLPSSTAFLV
QLTELIHCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQSAWTSQSNSLASCLSR
VSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNGCNSLMKKLQHLFAFL
AHTQVSISVYCECVKSPKRYCLKSGYVLSFCFFLLLSILIGNEFMLMERTSHIPEEKIDS
ELVELGEICSQIIFNISGPIRAIKEKKTLVGFHILNKRSRFSLHNFKSFSCIVFIFLPCR
RHVIMDQGDPASSGSSHDGGLMQGRVPGPSKEPGVYNPATAAFACDSAVSEGMVGSPDEF
RCAEDISVPNDSRKMLVNKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASL
QNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKILDNVSLPLVLELPVKRTTSFSSLSE
SWSLDVDFTDISENLAKKLKPSGTEEACCPKLVPYLLSSVVVHSGVSSESGHYYSYARNI
TGTECSYQLCHQPETLALASSQGHLPGRDSPSAVIEQDLENKEMSKEWFLFNDSRVTFTS
FQSVQKITSRFPKDTAYVLLYKKQNSTNSLGGSNSTTGLWVNGDPPLQKELMEAITKDNK
LYLQEQELNARARALQAASASCSFRPNGFDDNDPPGSCGPTGGGGGGGFNTVGRLVF
Download sequence
Identical sequences ENSSSCP00000009655 ENSSSCP00000021914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]