SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009744 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009744
Domain Number 1 Region: 329-578
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.16e-70
Family Eukaryotic proteases 0.00069
Further Details:      
 
Domain Number 2 Region: 111-217
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0058
Further Details:      
 
Domain Number 3 Region: 257-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 220-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 47-107
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000191
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009744   Gene: ENSSSCG00000009138   Transcript: ENSSSCT00000010006
Sequence length 588
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:120517326:120554337:1 gene:ENSSSCG00000009138 transcript:ENSSSCT00000010006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAHVILLLLCFYLSFCKVSSDTSQEDLVEKKCLTEKYTHLSCDKVFCQPWQKCIDGTC
ICKLPYQCPKNGTSVCSTNGKSYPTYCQQKSFECLRPEAKFLKSGACTGEEQFSVSLDRG
NGDSEGIVEVKLVDQDKKMYICAKSWSLTQANVACLDLGFKLGALYTQRRDPHINSPECL
HVHCRGSETSLAECTFTKGTTSRSEGLAGVVCYTENAVSPTNDYFQCVNGKHISQKKTCD
GINDCGDQSDELCCKGCRGESFFCKSGVCIPRKYKCNGEVDCITGEDEVGCEGSEHPEIK
AFMTYIIEETEMLTADMNAERKRIKSFFPKLSCGVKSSTHIRRKRVVGGQPAEVGDFPWQ
VAIKEGEKINCGGIYIGGCWILTAAHCVRASKAPRYQIWTSFTDWLNPDPQIVVQFVKQV
IIHEKYNGTTYQNDIALIEMKKQPGRSECVLLKSVPACVPWSPHLFQPNDKCIVSGWGRE
KDNKKVYSLKWGEVHLISNCSKFYLNRFFEKEMVCAGTDDGSIDACKGDSGGPLVCTDAN
NMTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISLHVGRPLISQHNV
Download sequence
Identical sequences ENSSSCP00000009744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]