SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009843 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009843
Domain Number 1 Region: 2689-2978
Classification Level Classification E-value
Superfamily BEACH domain 5.23e-124
Family BEACH domain 0.0000000156
Further Details:      
 
Domain Number 2 Region: 3049-3247,3410-3442
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-30
Family WD40-repeat 0.00095
Further Details:      
 
Domain Number 3 Region: 2535-2657
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3450-3519
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1089-1250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000422
Family Trypanosoma sialidase, C-terminal domain 0.064
Further Details:      
 
Domain Number 6 Region: 470-514,580-658,852-911
Classification Level Classification E-value
Superfamily ARM repeat 0.00000345
Family Armadillo repeat 0.074
Further Details:      
 
Domain Number 7 Region: 1410-1461,1513-1579,1609-1704
Classification Level Classification E-value
Superfamily ARM repeat 0.0000148
Family HspBP1 domain 0.052
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000009843
Domain Number - Region: 2345-2421
Classification Level Classification E-value
Superfamily Cyclin-like 0.000816
Family Retinoblastoma tumor suppressor domains 0.01
Further Details:      
 
Domain Number - Region: 111-414
Classification Level Classification E-value
Superfamily ARM repeat 0.0633
Family Armadillo repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009843   Gene: ENSSSCG00000009230   Transcript: ENSSSCT00000010109
Sequence length 3527
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:143175327:143414703:1 gene:ENSSSCG00000009230 transcript:ENSSSCT00000010109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEIHQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPLA
ERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLLWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVSDLKPAGVSTGAP
FLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTNFLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKISKLPEVQNKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSI
IAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALNEQGDARNNSSFE
DQKHLALLVMETLTVLLQGSNTNAGIFREFGGARCAHNIVRYPQCRQHALMIIQQLVLSP
NGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVA
MERSLSSPPKNGWEKVNQHQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISPVNVFPSNTQPFQRLLEEDAVLVDAVSPTLRHCSKLFIYLYKVATDSF
DSRAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPIYPPKNVADLKLHVAASSLQ
SSDAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVANILQSLVHTERNQQVMCEAGL
HARLLQRCSAALADEDHALHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLL
KQYRVHKPSSLSYEPEMRSSMITSMEGLGSDNVFSLHEDNHYRISKSLVKSAEGSTVPLT
RVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLTD
GAVVSGIGSGERFFPPPSGLSYSSWFCIEHFSSPPNNHPVRLLTIVRRASSSEQHYVCLA
VVLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIVEGQWHHLVLVM
SKGMLKNSTAALYIDGQLVGTVKLHYVHSTPGGSGSANPPVVSTVYAYMGTPPAQRQIAS
LVWRLGPTHFLEEVLPPANVTTIFELGPNYVGSFQAVCLPCKDAKSEGVVPSPVSLVPEE
KVSFGLYALSVSALTVARIRKVCNKLDSKAIAKQLGISSHENATPVKLVHNSAGHLNGPA
RTIGATLIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKS
NPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSAAFQD
LLCDFDVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQ
PTIAAISNVLSFLLQGFPSSNDLLRFGQFISSTLPTFAVCEKFVVMEINHEEKPDTGTEE
EFGGLVSANLILLRNRLLDILLKLIYTSKEKTSINLQACEELVRTLGFDWVVMFMEEHLH
PSTVTAALRILVALLSSPSILVKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGR
STVREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQVSVPVVS
SRCKQGFQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAAFLLLGMLRSMLHSPWQSEEE
GSWLREYPVTLMQFFRYLYHNVPDLASMWMSPDFLCALAATVFPSNIRPYSEMVTDLDDE
VGSPAEEFKAFAADTGMNRSQSEYCNVGVKTYLTNHPAKKFVFDFMRVLIIDNLCLTPAS
KQTPLIDLLLEASPERSTRTQQKEFQTYILDSVMDHLLAADVLLGEDASLPITSGGSYQV
LVNNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLPLDAVYHCLNRTIL
YQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDGF
GLEAEARMTTWHIMIPSDIEPDGAYSQDISEGRQLLIKAVNRVWTELIHSKKQVLEEIFK
VTLPVNERGHVDIAIARPLIEEASLKCWQNHLAHEKKCISRGEALAPTTQSKLSRVSSGF
GLSKLTGSRRNRKESGLHKHSLSTQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYV
TEEWCQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPET
EQETNVASEVPSKQPETPDDIIPQKKPARYRRAISYDSKEYYMRLASGNPAIVQDAIVES
SEGEATQQEPEHGEDTIAKVKGLVKPPLKRSRSAPDGGDEETQEQLQDQVAEGSSMEEEE
KTDNATLLRLLEDGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDI
ETLPPNMHEPIIPRGARQGPSQLKRTCSIFAYEDIKEVHKRRYLLQPIAVEVFSGDGRNY
LLAFQKGIRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWE
RGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQ
TDERLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFD
LADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVIL
PPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQ
VDIYNINDPLKETATIGFINNFGQIPKQQLFKKPHPPKRVRSRLNGDNAGISVPPGCTSD
KIFFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLS
CRLGTYESDKAVTVYECLSEWGQILCAICPNPKLVITGGTSTVVCVWEMGTSKEKARTLT
LKQGLLGHTDTVTCATSLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINE
LTGDIVSCAGTHIHVWSINGNPVVSVNTFTGRSQQIVCCCVSEMNEWDTQNVIVTGHSDG
VVRFWRMEFLQVPETPAPEPVEVLEMQEDCPETQIGQEAQDEDSSDSEAEEQSISQDPKD
TPSQPSSTSHRPRAASCRATATWCNDSGSDDSRRWSDQLSLDERDGFILVNYSEGRARAH
LQPPLNHPHPSPVEVRNYNRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEITALGVS
KDHSRILVGDSRGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNC
GQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHERGSEDAPRNC
Download sequence
Identical sequences ENSSSCP00000009843 ENSSSCP00000009843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]