SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009924 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009924
Domain Number 1 Region: 41-371
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.79e-91
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009924   Gene: ENSSSCG00000009302   Transcript: ENSSSCT00000010190
Sequence length 374
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:4029943:4071402:-1 gene:ENSSSCG00000009302 transcript:ENSSSCT00000010190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REVVCVLSRVQLCKAAVSYFGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQA
LYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENEL
FDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDTENNHSTPDPTWVHEIF
QGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEEC
RSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNP
DRMYDLVAVVVHCGSGPHRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISK
NSESGYILFYQSRD
Download sequence
Identical sequences ENSSSCP00000009924 ENSSSCP00000009924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]