SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009929 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009929
Domain Number 1 Region: 158-246
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 2.22e-20
Family Translation initiation factor IF3, C-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 78-146
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.000000000772
Family Translation initiation factor IF3, N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009929   Gene: ENSSSCG00000029215   Transcript: ENSSSCT00000010195
Sequence length 278
Comment pep:known chromosome:Sscrofa10.2:11:4320756:4335440:1 gene:ENSSSCG00000029215 transcript:ENSSSCT00000010195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALFLKRLTFQTIRTETSCTARCLGERVGQKTSPAPPHPVASAPRPSCLIHAKAFSTED
TQEERKKKKKDETAFSNIGRKIHERIIHVLDEQGNDLGHMHRANVIRLMAERDLRLVRRD
PGAEPPQYQLLTGAQIHQERLRLREAGRAEPKPAGPTLTKELTFSSNIGQHDLDTKSKQI
QQWIEKKYKVQITIKKGRNAEEPENKMEELCNQILQTMHGIATFSSRPQLIRGGKAMMCV
LRPLSRKEEANRAAQGPPRGDPLSREDGNHGASDVLHQ
Download sequence
Identical sequences ENSSSCP00000009928 ENSSSCP00000009929 ENSSSCP00000009928 ENSSSCP00000009929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]