SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010006 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010006
Domain Number 1 Region: 343-393
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000916
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010006   Gene: ENSSSCG00000009377   Transcript: ENSSSCT00000010274
Sequence length 859
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:16006494:16035388:1 gene:ENSSSCG00000009377 transcript:ENSSSCT00000010274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQTLKDFSNLLLVVLCDYVLGEAEYLLLGEPGHVALSNSTVTVAFQYFDGTNGTLRNVS
VLLLEANTNQTLTTKYLLTNQSQGTLEFECFYFREAGDYWFTMSPEATNSSAPAPRWERS
AFLKVEWPDFHVHLNRTSRAAEGTFQVGLFTSQPLCPFPVDKPDIVVDVIFTNSLPEAST
SQGQPLEIRASKRAELSQGQWLEFGCAPVGPEAYVTVVLKLLGRDSVISSTGPIDLAQKF
GYKLVMAPELTCESRVEVMVLPPPCIFVQGVVAVYKEAPRRPGEGTPRLAENSLSLGERR
TVFNCTLFDVGRHKYCFDFGVSSRSQFSAKEKECMLIQRTIETWGLWQPWSQCSASCGDG
VRERRRLCLSSFPSRPGCPGVSSEASPCSLEDCAAFQTSSPSPLQPQGPAKSNNIVTVTG
ISLCLFIIVATVLITLWRKLGRSPTCSTPARPNSLHGPGCRKNSDEENICELGEPRGSFS
DAGDGPAGSPGSPGDLGIPLTYRRSAPAAPDEDASGSESFQSTAQKIIPPLFSYRLAQQQ
LKEMKKKGLTETTKVYHVSQSPLTDTAIDAATAAAAAAPRDPEVPEDAAAAKFRIKAPFL
EQPPAPGAGDRPPSRLDLPLVQAAVSPSQTVIRKSQARHAGGRGAPPDRGHPRGSHFRRT
ASFHEAKQARPFRERSLSALTPRQAPAYASRTRTWDQAEDRVRPQSRGAAPFPEKPDHCQ
GAGGTSGLLSPLPKPHASGQPTRKPDLGDRQVGFVAGGERTEPHRARRGPSPSHRSVSRK
QPSPTAPKESYQRVSPLSPSQSRKDKCQSFPAHPEFAFYDNTSFGLTESEQRMLDLPGYF
GSNEEDETTSTLSVEKLVI
Download sequence
Identical sequences ENSSSCP00000010006 9823.ENSSSCP00000010006 ENSSSCP00000010006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]